| Basic Information | |
|---|---|
| Taxon OID | 3300022544 Open in IMG/M |
| Scaffold ID | Ga0212120_1022683 Open in IMG/M |
| Source Dataset Name | Jinze_combined assembly |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1431 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Baoshan, Yunnan, China | |||||||
| Coordinates | Lat. (o) | 25.4413 | Long. (o) | 98.46 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F079345 | Metagenome / Metatranscriptome | 116 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0212120_10226833 | F079345 | GGAGG | MLSKALNLELEGLSVLQRKLLLQLLHRRYPHYWDKFTSHEYTWQSRKEALEEFLQNHQTELVKEFVRAGLHGNGWKTTRRSGARVQG |
| ⦗Top⦘ |