| Basic Information | |
|---|---|
| Taxon OID | 3300022541 Open in IMG/M |
| Scaffold ID | Ga0212117_1008769 Open in IMG/M |
| Source Dataset Name | Gongxiaoshe_combined assembly |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2408 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | China: Gongxiaoshe hot spring | |||||||
| Coordinates | Lat. (o) | 25.4401 | Long. (o) | 98.4408 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F045123 | Metagenome / Metatranscriptome | 153 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0212117_10087691 | F045123 | AGGAG | MRRRAKPSGKPTTRVRQILTQLGYVEHEDFEYEVEIRLYSNRRLYADVMLFQGDAPIAVVEVEGKPSLLREGFEEARFKGAAWNLENPVPLLWVAAGERDALYRLTRPCNGICYAPLSEQTLPQALAPAQLATLIGDYLQQTDAPLGQSLRDRNLLRDALQA |
| ⦗Top⦘ |