3300022541: Gongxiaoshe_combined assembly

Overview

Basic Information

• IMG/M Taxon OID: 3300022541
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0111485 | Gp0127788 | Ga0212117
• Sample Name: Gongxiaoshe_combined assembly
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 126182832
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline)

Location Information

• Location: China: Gongxiaoshe hot spring
• Coordinates
  • Lat. (^o): 25.4401
  • Long. (^o): 98.4408
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F045123	Metagenome / Metatranscriptome	153	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0212117_1008769	All Organisms → cellular organisms → Bacteria	2408

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0212117_1008769	Ga0212117_10087691	F045123	MRRRAKPSGKPTTRVRQILTQLGYVEHEDFEYEVEIRLYSNRRLYADVMLFQGDAPIAVVEVEGKPSLLREGFEEARFKGAAWNLENPVPLLWVAAGERDALYRLTRPCNGICYAPLSEQTLPQALAPAQLATLIGDYLQQTDAPLGQSLRDRNLLRDALQA