| Basic Information | |
|---|---|
| Taxon OID | 3300022375 Open in IMG/M |
| Scaffold ID | Ga0210313_1029742 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1183 (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 648 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Oregon | |||||||
| Coordinates | Lat. (o) | 46.234 | Long. (o) | -123.909 | Alt. (m) | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F016139 | Metagenome / Metatranscriptome | 249 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0210313_10297421 | F016139 | AGCAG | MKKSGAGQEISHGTISLLAHSSDINDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHALDGLHLSGDLNEWLSIIESLEDSSGKSLLDVLDGSGLGNGGITISSGLRLEGGVELGLKGDEELIFVHVLEGGLGVNELVVVVVVVSRTMAGSARRMVFVA |
| ⦗Top⦘ |