NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0224503_10176660

Scaffold Ga0224503_10176660


Overview

Basic Information
Taxon OID3300022201 Open in IMG/M
Scaffold IDGa0224503_10176660 Open in IMG/M
Source Dataset NameSediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_21
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)690
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment → Estuarine Microbial Communities From The San Francisco Bay-Delta (Sfbd), California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)37.79Long. (o)-122.36Alt. (m)Depth (m)17
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005843Metagenome / Metatranscriptome388Y
F009460Metagenome / Metatranscriptome317N
F064688Metagenome / Metatranscriptome128N

Sequences

Protein IDFamilyRBSSequence
Ga0224503_101766601F005843N/AFMMALALRLNMKVGLKMTLAEPVFMAFAVFSSVDECKAFAKYYDLARIFEPQCVEMGGEADYRRPWPDVRPQPRPTQENNNG
Ga0224503_101766602F009460AGGAGMAKWDLSKLENSASVGAHIDEDSSTPTQPTPQMLVMSIRRKADIMRMDAGRGPERLTIKQRAEEIISLCDMLERRL
Ga0224503_101766603F064688GGAGMTEHMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHDELSVGDLCSMIEQDAV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.