NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F064688

Metagenome / Metatranscriptome Family F064688

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F064688
Family Type Metagenome / Metatranscriptome
Number of Sequences 128
Average Sequence Length 59 residues
Representative Sequence MTENLTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSR
Number of Associated Samples 107
Number of Associated Scaffolds 128

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 100.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 91.41 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (67.969 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(28.906 % of family members)
Environment Ontology (ENVO) Unclassified
(66.406 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(84.375 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 70.91%    β-sheet: 0.00%    Coil/Unstructured: 29.09%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 128 Family Scaffolds
PF00145DNA_methylase 15.62
PF01541GIY-YIG 3.12
PF13539Peptidase_M15_4 2.34
PF02592Vut_1 1.56
PF04545Sigma70_r4 1.56
PF13884Peptidase_S74 0.78
PF00182Glyco_hydro_19 0.78
PF14279HNH_5 0.78
PF02945Endonuclease_7 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 128 Family Scaffolds
COG0270DNA-cytosine methylaseReplication, recombination and repair [L] 15.62
COG1738Queuosine precursor transporter YhhQ, DUF165 familyTranslation, ribosomal structure and biogenesis [J] 1.56
COG3179Chitinase, GH19 familyCarbohydrate transport and metabolism [G] 0.78
COG3979ChitodextrinaseCarbohydrate transport and metabolism [G] 0.78


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms79.69 %
UnclassifiedrootN/A20.31 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000116|DelMOSpr2010_c10124744All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales923Open in IMG/M
3300000117|DelMOWin2010_c10168305All Organisms → cellular organisms → Bacteria → Proteobacteria704Open in IMG/M
3300004113|Ga0065183_10722657Not Available524Open in IMG/M
3300006027|Ga0075462_10128696All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium779Open in IMG/M
3300006027|Ga0075462_10183912All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales631Open in IMG/M
3300006029|Ga0075466_1123062All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales686Open in IMG/M
3300006637|Ga0075461_10000152Not Available17324Open in IMG/M
3300006637|Ga0075461_10249959All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales520Open in IMG/M
3300006752|Ga0098048_1141773All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium718Open in IMG/M
3300006752|Ga0098048_1176449All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales634Open in IMG/M
3300006789|Ga0098054_1045581All Organisms → Viruses → Predicted Viral1690Open in IMG/M
3300006789|Ga0098054_1196818All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales735Open in IMG/M
3300006793|Ga0098055_1400628All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales508Open in IMG/M
3300006810|Ga0070754_10257625All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales795Open in IMG/M
3300006869|Ga0075477_10278523All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium668Open in IMG/M
3300006870|Ga0075479_10438633All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Eggerthellales → Eggerthellaceae → Adlercreutzia502Open in IMG/M
3300006919|Ga0070746_10295552All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales745Open in IMG/M
3300006922|Ga0098045_1087341All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium742Open in IMG/M
3300006925|Ga0098050_1074237Not Available879Open in IMG/M
3300007229|Ga0075468_10067384All Organisms → Viruses → Predicted Viral1181Open in IMG/M
3300007229|Ga0075468_10230739All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales530Open in IMG/M
3300007276|Ga0070747_1347678All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales507Open in IMG/M
3300007345|Ga0070752_1232539Not Available723Open in IMG/M
3300007345|Ga0070752_1306835All Organisms → cellular organisms → Bacteria → Proteobacteria604Open in IMG/M
3300007345|Ga0070752_1369230Not Available536Open in IMG/M
3300007345|Ga0070752_1380652Not Available525Open in IMG/M
3300007346|Ga0070753_1141277All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium917Open in IMG/M
3300007539|Ga0099849_1242424All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium665Open in IMG/M
3300007539|Ga0099849_1300157All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales580Open in IMG/M
3300007540|Ga0099847_1222632All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales547Open in IMG/M
3300007558|Ga0102822_1170822Not Available516Open in IMG/M
3300007640|Ga0070751_1176002All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-13843Open in IMG/M
3300007640|Ga0070751_1271595All Organisms → cellular organisms → Bacteria → Proteobacteria638Open in IMG/M
3300007715|Ga0102827_1116994Not Available606Open in IMG/M
3300009001|Ga0102963_1260254Not Available686Open in IMG/M
3300009079|Ga0102814_10129627All Organisms → Viruses → Predicted Viral1380Open in IMG/M
3300009423|Ga0115548_1168626All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium685Open in IMG/M
3300009426|Ga0115547_1255870Not Available546Open in IMG/M
3300009435|Ga0115546_1248488All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium610Open in IMG/M
3300009472|Ga0115554_1345693All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium585Open in IMG/M
3300010149|Ga0098049_1155936All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium705Open in IMG/M
3300010150|Ga0098056_1151572All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium783Open in IMG/M
3300010296|Ga0129348_1141582All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales835Open in IMG/M
3300010368|Ga0129324_10105210All Organisms → cellular organisms → Bacteria → Proteobacteria1213Open in IMG/M
3300010392|Ga0118731_111208983All Organisms → Viruses → Predicted Viral1178Open in IMG/M
3300011118|Ga0114922_11192020All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria616Open in IMG/M
3300011118|Ga0114922_11270133Not Available594Open in IMG/M
3300011251|Ga0151676_1024461All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium556Open in IMG/M
3300016737|Ga0182047_1417433All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium853Open in IMG/M
3300016776|Ga0182046_1607523All Organisms → Viruses → Predicted Viral1121Open in IMG/M
3300017728|Ga0181419_1118572All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium645Open in IMG/M
3300017732|Ga0181415_1109167Not Available623Open in IMG/M
3300017734|Ga0187222_1005935All Organisms → Viruses → Predicted Viral3151Open in IMG/M
3300017735|Ga0181431_1131977All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium556Open in IMG/M
3300017744|Ga0181397_1063514All Organisms → Viruses → Predicted Viral1003Open in IMG/M
3300017749|Ga0181392_1207626All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium561Open in IMG/M
3300017750|Ga0181405_1034243All Organisms → Viruses → Predicted Viral1373Open in IMG/M
3300017751|Ga0187219_1223759Not Available513Open in IMG/M
3300017752|Ga0181400_1222970Not Available514Open in IMG/M
3300017753|Ga0181407_1122496Not Available648Open in IMG/M
3300017764|Ga0181385_1262880All Organisms → cellular organisms → Bacteria → Proteobacteria516Open in IMG/M
3300017776|Ga0181394_1060431All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1258Open in IMG/M
3300017776|Ga0181394_1209705Not Available591Open in IMG/M
3300017776|Ga0181394_1267902All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales509Open in IMG/M
3300017781|Ga0181423_1381541Not Available510Open in IMG/M
3300017781|Ga0181423_1389306Not Available504Open in IMG/M
3300017782|Ga0181380_1087060All Organisms → cellular organisms → Bacteria → Proteobacteria1090Open in IMG/M
3300017786|Ga0181424_10456609All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales515Open in IMG/M
3300018413|Ga0181560_10364572All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales667Open in IMG/M
3300018417|Ga0181558_10718247Not Available507Open in IMG/M
3300019730|Ga0194001_1008799All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium975Open in IMG/M
3300019749|Ga0193983_1048166All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium625Open in IMG/M
3300020052|Ga0181554_1048943All Organisms → Viruses → Predicted Viral2301Open in IMG/M
3300021347|Ga0213862_10353088All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium524Open in IMG/M
3300021371|Ga0213863_10014261All Organisms → Viruses → Predicted Viral4773Open in IMG/M
3300021375|Ga0213869_10057638All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales1998Open in IMG/M
3300021375|Ga0213869_10277656All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium722Open in IMG/M
3300021389|Ga0213868_10131660All Organisms → cellular organisms → Bacteria → Proteobacteria1572Open in IMG/M
3300021959|Ga0222716_10415016All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales778Open in IMG/M
3300021961|Ga0222714_10372484All Organisms → cellular organisms → Bacteria → Proteobacteria761Open in IMG/M
3300022071|Ga0212028_1053567All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005)754Open in IMG/M
3300022072|Ga0196889_1046887All Organisms → cellular organisms → Bacteria → Proteobacteria844Open in IMG/M
3300022164|Ga0212022_1023956All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria922Open in IMG/M
3300022187|Ga0196899_1094513All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium895Open in IMG/M
3300022187|Ga0196899_1211438Not Available509Open in IMG/M
3300022201|Ga0224503_10176660All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium690Open in IMG/M
3300022218|Ga0224502_10291350All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales630Open in IMG/M
3300022223|Ga0224501_10166715All Organisms → cellular organisms → Bacteria → Proteobacteria1242Open in IMG/M
3300022928|Ga0255758_10109638All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1440Open in IMG/M
3300022929|Ga0255752_10401500All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales539Open in IMG/M
(restricted) 3300022938|Ga0233409_10133721All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium807Open in IMG/M
(restricted) 3300024059|Ga0255040_10287778All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales685Open in IMG/M
(restricted) 3300024062|Ga0255039_10031575All Organisms → cellular organisms → Bacteria → Proteobacteria1935Open in IMG/M
3300024221|Ga0228666_1000608All Organisms → cellular organisms → Bacteria19193Open in IMG/M
3300024266|Ga0228661_1117240Not Available501Open in IMG/M
3300024313|Ga0228624_1001304All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales10142Open in IMG/M
3300024346|Ga0244775_10122474All Organisms → cellular organisms → Bacteria → Proteobacteria2203Open in IMG/M
3300024346|Ga0244775_10275444All Organisms → Viruses → Predicted Viral1399Open in IMG/M
(restricted) 3300024517|Ga0255049_10300251All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium738Open in IMG/M
(restricted) 3300024518|Ga0255048_10301868All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium776Open in IMG/M
3300025070|Ga0208667_1014943All Organisms → Viruses → Predicted Viral1645Open in IMG/M
3300025083|Ga0208791_1025764All Organisms → cellular organisms → Bacteria → Proteobacteria1147Open in IMG/M
3300025085|Ga0208792_1005203Not Available3329Open in IMG/M
3300025085|Ga0208792_1028588Not Available1118Open in IMG/M
3300025108|Ga0208793_1111806All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium755Open in IMG/M
3300025132|Ga0209232_1217508Not Available573Open in IMG/M
3300025508|Ga0208148_1003626All Organisms → cellular organisms → Bacteria5278Open in IMG/M
3300025652|Ga0208134_1160090All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales558Open in IMG/M
3300025653|Ga0208428_1086639All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005)897Open in IMG/M
3300025671|Ga0208898_1095657All Organisms → cellular organisms → Bacteria → Proteobacteria916Open in IMG/M
3300025759|Ga0208899_1162167All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingopyxis → Sphingopyxis fribergensis751Open in IMG/M
3300025759|Ga0208899_1179593All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales693Open in IMG/M
3300025806|Ga0208545_1054592All Organisms → cellular organisms → Bacteria → Proteobacteria1169Open in IMG/M
3300025815|Ga0208785_1138750Not Available566Open in IMG/M
3300025853|Ga0208645_1123173All Organisms → Viruses → Predicted Viral1030Open in IMG/M
3300026511|Ga0233395_1013396All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium3022Open in IMG/M
3300027525|Ga0208437_1062133All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium885Open in IMG/M
(restricted) 3300027856|Ga0255054_10660993All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium505Open in IMG/M
(restricted) 3300027861|Ga0233415_10070229All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Rubinisphaera → unclassified Rubinisphaera → Rubinisphaera sp.1498Open in IMG/M
3300028130|Ga0228619_1011868All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium3053Open in IMG/M
3300028273|Ga0228640_1112389All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales525Open in IMG/M
3300032136|Ga0316201_10984643All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales709Open in IMG/M
3300032274|Ga0316203_1175962All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium591Open in IMG/M
3300032277|Ga0316202_10061740All Organisms → cellular organisms → Bacteria → Proteobacteria1747Open in IMG/M
3300032277|Ga0316202_10139945All Organisms → cellular organisms → Bacteria → Proteobacteria1123Open in IMG/M
3300032277|Ga0316202_10563217Not Available536Open in IMG/M
3300032373|Ga0316204_10545506All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria858Open in IMG/M
3300034418|Ga0348337_052866All Organisms → Viruses → Predicted Viral1614Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous28.91%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater15.62%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine11.72%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater8.59%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh5.47%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater3.91%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat3.91%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine3.12%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine3.12%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment2.34%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment1.56%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface1.56%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.56%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine1.56%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.56%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine1.56%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine0.78%
Worm BurrowEnvironmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow0.78%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.78%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.78%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water0.78%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300004113Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_12 (version 2)EnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006637Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNAEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006869Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006870Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006922Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaGEnvironmentalOpen in IMG/M
3300006925Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaGEnvironmentalOpen in IMG/M
3300007229Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007558Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.733EnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300007715Estuarine microbial communities from the Columbia River estuary - metaG S.751EnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009423Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423EnvironmentalOpen in IMG/M
3300009426Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420EnvironmentalOpen in IMG/M
3300009435Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413EnvironmentalOpen in IMG/M
3300009472Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404EnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010150Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaGEnvironmentalOpen in IMG/M
3300010296Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNAEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300011118Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaGEnvironmentalOpen in IMG/M
3300011251Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.2EnvironmentalOpen in IMG/M
3300016737Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011506CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016776Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011505AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017728Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24EnvironmentalOpen in IMG/M
3300017732Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11EnvironmentalOpen in IMG/M
3300017734Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2)EnvironmentalOpen in IMG/M
3300017735Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21EnvironmentalOpen in IMG/M
3300017744Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23EnvironmentalOpen in IMG/M
3300017749Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15EnvironmentalOpen in IMG/M
3300017750Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29EnvironmentalOpen in IMG/M
3300017751Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2)EnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017753Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26EnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300017776Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017786Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18EnvironmentalOpen in IMG/M
3300018413Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018417Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019730Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_7-8_MGEnvironmentalOpen in IMG/M
3300019749Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLT_4-5_MGEnvironmentalOpen in IMG/M
3300020052Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011503CT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300021347Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266EnvironmentalOpen in IMG/M
3300021371Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497EnvironmentalOpen in IMG/M
3300021375Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132EnvironmentalOpen in IMG/M
3300021389Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127EnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300022071Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2)EnvironmentalOpen in IMG/M
3300022072Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3)EnvironmentalOpen in IMG/M
3300022164Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2)EnvironmentalOpen in IMG/M
3300022187Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3)EnvironmentalOpen in IMG/M
3300022201Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_21EnvironmentalOpen in IMG/M
3300022218Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_13EnvironmentalOpen in IMG/M
3300022223Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_8_1EnvironmentalOpen in IMG/M
3300022928Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaGEnvironmentalOpen in IMG/M
3300022929Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaGEnvironmentalOpen in IMG/M
3300022938 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_13_MGEnvironmentalOpen in IMG/M
3300024059 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2EnvironmentalOpen in IMG/M
3300024062 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1EnvironmentalOpen in IMG/M
3300024221Seawater microbial communities from Monterey Bay, California, United States - 80DEnvironmentalOpen in IMG/M
3300024266Seawater microbial communities from Monterey Bay, California, United States - 75DEnvironmentalOpen in IMG/M
3300024313Seawater microbial communities from Monterey Bay, California, United States - 29DEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300024517 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_3EnvironmentalOpen in IMG/M
3300024518 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2EnvironmentalOpen in IMG/M
3300025070Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025083Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025085Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025108Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025132Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes)EnvironmentalOpen in IMG/M
3300025508Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025652Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes)EnvironmentalOpen in IMG/M
3300025653Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025671Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025806Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025815Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300026511Seawater microbial communities from Monterey Bay, California, United States - 27DEnvironmentalOpen in IMG/M
3300027525Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 (SPAdes)EnvironmentalOpen in IMG/M
3300027856 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_23EnvironmentalOpen in IMG/M
3300027861 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MGEnvironmentalOpen in IMG/M
3300028130Seawater microbial communities from Monterey Bay, California, United States - 22DEnvironmentalOpen in IMG/M
3300028273Seawater microbial communities from Monterey Bay, California, United States - 51DEnvironmentalOpen in IMG/M
3300032136Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrowEnvironmentalOpen in IMG/M
3300032274Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 1EnvironmentalOpen in IMG/M
3300032277Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotiteEnvironmentalOpen in IMG/M
3300032373Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2EnvironmentalOpen in IMG/M
3300034418Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSpr2010_1012474453300000116MarineMTEHMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRC
DelMOWin2010_1016830513300000117MarineMTESMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIRRCLKRHG
Ga0065183_1072265713300004113Pelagic MarineVTEHMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSR
Ga0075462_1012869643300006027AqueousVTENMTPLERWKELAIIENARMKRRLIGRDDMHAYAHK
Ga0075462_1018391233300006027AqueousMTESLTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHDELSVGDLCSMIEQDAVHIDIGLKTMRERR
Ga0075466_112306243300006029AqueousMTESLTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKL
Ga0075461_1000015213300006637AqueousVTENMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHGELSVGDLCSMIEQDAVHIDIGLKTM
Ga0075461_1024995923300006637AqueousMTESLTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHGELSVGDLCSMIEQDAVHIDIGLKTM
Ga0098048_114177313300006752MarineVTESLTPLERWKELAIIENARMKRRLIGRDDMHAYA
Ga0098048_117644933300006752MarineMTESLTPLERWKELAIIENARMKRRLIGRDDMHAY
Ga0098054_104558153300006789MarineMTESLTPLERWKELAIIENARMKRRLIGRDVMHAYAYKPWPLEKLRKEIKRCLSRH
Ga0098054_119681843300006789MarineMTESLTPLERWKELAIIENARMKRRLIGRDVMHAYAYKPWPLEKLRKEIKRCLSRHD
Ga0098055_140062813300006793MarineMTENLTPLERWKELAIIENARMKRRLIGRDVMHAYAYKPWPLEK
Ga0070754_1025762533300006810AqueousMTESLTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHSELSVGDLCSMIDQDAVHIDIGLK
Ga0075477_1027852333300006869AqueousVTENMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIK
Ga0075479_1043863313300006870AqueousMTEHMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHGELSVGD
Ga0070746_1029555213300006919AqueousMTEHMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHDELSVGDL
Ga0098045_108734113300006922MarineVTESLTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEK
Ga0098050_107423713300006925MarineMTESLTPLERWKELAIIENARMKRRLIGRDVMHAYAYKP
Ga0075468_1006738453300007229AqueousMTEYMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKP
Ga0075468_1023073933300007229AqueousMTESLTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHS
Ga0070747_134767813300007276AqueousMTENLTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHNELSVGDLCSMIEQDAVHIDIGLKTMRERRT
Ga0070752_123253913300007345AqueousMTEHMTPLERWKELAIIENARMKRRLIGRDDMHAYAYKP
Ga0070752_130683523300007345AqueousMTEHMTPLERWKELAIIENARMKRRLIGRDDMHAYAYKPWPLEKLRKEIKRCLSRHGELSVGDLCSMIEQDAVHIDIGLKTMRERR
Ga0070752_136923013300007345AqueousMTESLTPLERWKELAIIENARMKRRLIGRDDMHAYAYKPWPLEKLRKEIKRCLSRHGELSVGDLCSMIEQDAVHIDIG
Ga0070752_138065223300007345AqueousMTENMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLE
Ga0070753_114127713300007346AqueousVTENMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEI
Ga0099849_124242413300007539AqueousMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHDELSVGDLCSMIEQDAVHIDIG
Ga0099849_130015733300007539AqueousMTENMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHNELSVGDLCSMIEQDAVHIDI
Ga0099847_122263223300007540AqueousMTENLTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLS
Ga0102822_117082223300007558EstuarineMTEHLTPLEHWKEPAIIENARMKRRLIGRDEMHAYAYKPWPLEKLRKEIKRCLSRHDELSVGDLCSMIE
Ga0070751_117600243300007640AqueousVTENMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHGE
Ga0070751_127159513300007640AqueousMTEHMTPLERWKELAIIENARMKRRLIGRDDMHAYAYKPWPL
Ga0102827_111699413300007715EstuarineMTENLTPLERWKELAIIENARMKRRLIGRDDMHAYAYKPWPLEKLRKEIKRCLSRHDELSVGDLCSMIEQDAVHIDIGLKT
Ga0102963_126025413300009001Pond WaterMTENLTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHDE
Ga0102814_1012962713300009079EstuarineMTENLTPLERWKELAIIENARMKRRLIGRDDMHAYAYKP
Ga0115548_116862613300009423Pelagic MarineMTESLTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIK
Ga0115547_125587013300009426Pelagic MarineVTESLTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHGELSVGDLCSMIDQDAVHIDVGLRTMRE
Ga0115546_124848823300009435Pelagic MarineVTENLTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHSELSVGDLCSMIEQDAVHIDIGLKTMRERR
Ga0115554_134569313300009472Pelagic MarineVTENLTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHNELSVGDL
Ga0098049_115593613300010149MarineVTESLTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWP
Ga0098056_115157243300010150MarineVTESLTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHSELSVGDLCSMIEQDAVHIDIGLKTM
Ga0129348_114158233300010296Freshwater To Marine Saline GradientMTEYMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHNELSVGDLCSMIEQDAVHIDIGLKTMRERRT
Ga0129324_1010521043300010368Freshwater To Marine Saline GradientVTESLTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEI
Ga0118731_11120898313300010392MarineMTEHMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHNELSVGDLCSM
Ga0114922_1119202033300011118Deep SubsurfaceVTESLTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLR
Ga0114922_1127013343300011118Deep SubsurfaceMTENLTPLERWKELAIIENARMKRRLIGRDDMHAYAHKP
Ga0151676_102446133300011251MarineMTEHRTPLERWKELAIIENARMKRRLIGRDDKHAYAHKPWPLEVLRKEIKRC
Ga0182047_141743313300016737Salt MarshVTESLTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRC
Ga0182046_160752343300016776Salt MarshMTESLTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCL
Ga0181419_111857233300017728SeawaterVTEYMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHDELSVGDLCSMIEQDAVHIDIGLKTMRE
Ga0181415_110916723300017732SeawaterMTENMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEI
Ga0187222_1005935103300017734SeawaterMTEHMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHNELSVGDLCSMIEQ
Ga0181431_113197713300017735SeawaterVTEHMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCL
Ga0181397_106351413300017744SeawaterMTESLTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHDELSVGDLCSMIEQDAVHIDIGLKTMRERRT
Ga0181392_120762613300017749SeawaterVTEHMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEI
Ga0181405_103424313300017750SeawaterMTESLTPLERWKELAIIENARMKRRLMGRDDMLAYAHKPWPLEKLRKEIKRCLSRHDELS
Ga0187219_122375913300017751SeawaterVTEHMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHEELSVGDLCSMIE
Ga0181400_122297013300017752SeawaterVTEHMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRK
Ga0181407_112249633300017753SeawaterMTESLTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHGELSVGDLCSMIF
Ga0181385_126288013300017764SeawaterMTENLTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHSELSVGDLCSMIEQDAVHIDI
Ga0181394_106043163300017776SeawaterVTEYMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHDELSVGDLC
Ga0181394_120970523300017776SeawaterMTEDLTPLERWKELAIIENARMKRRLIGRDVMHAYAYKPWPLEKLRKEIKRCLSRHDELSVGDLCSMIEQDAVHIDIGLKT
Ga0181394_126790213300017776SeawaterMTEHMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHDELSVG
Ga0181423_138154113300017781SeawaterVTENLTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHDELS
Ga0181423_138930623300017781SeawaterMTESLTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHSELSVGDLCSMIE
Ga0181380_108706013300017782SeawaterMTEHMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWP
Ga0181424_1045660923300017786SeawaterMTEHMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHSELSVGDLCSMIEQDAVHIDIGLKTMRE
Ga0181560_1036457213300018413Salt MarshMTDSLTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHGELSVGDLCSMIEQDAVHIDIGLKTMRERR
Ga0181558_1071824723300018417Salt MarshMTESLTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHGELSVGDLCSMIEQDAVHIDIGLKTMRERRT
Ga0194001_100879963300019730SedimentVTENMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHGELSVGDLCSM
Ga0193983_104816633300019749SedimentVTEHMTPLERWKELAIIENARMKRRLIGRDDMHAYA
Ga0181554_104894383300020052Salt MarshVTESLTPLERWKELAIIENARMKRRLIGRDDMHAY
Ga0213862_1035308833300021347SeawaterVTEHMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHGEM
Ga0213863_1001426113300021371SeawaterVTEHMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPL
Ga0213869_1005763813300021375SeawaterMTEHMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHDELSVGDLCSMIEQDAVHIDIGLKTMRERRT
Ga0213869_1027765613300021375SeawaterMTEHMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKR
Ga0213868_1013166043300021389SeawaterMTEHMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPL
Ga0222716_1041501613300021959Estuarine WaterMTEHMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHGEL
Ga0222714_1037248423300021961Estuarine WaterMTEHLTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHDELSVGDLCSMIEQDAVHIDIGLK
Ga0212028_105356723300022071AqueousMTEHMTPLERWKELAIIENARMKRRLIGRDDMHAYAYKPWPLEKLR
Ga0196889_104688713300022072AqueousVTEHMTPLERWKELAIIENARMKRRLIGRDDMHAYAHP
Ga0212022_102395633300022164AqueousMTENMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHSELSVGDLCS
Ga0196899_109451343300022187AqueousMTEHMTPLERWKELAIIENARMKRRLIGRDDMHAYAYKPWPLEKLRKEIKRCLSRHGELSVGDLCSMIEQDAVHI
Ga0196899_121143823300022187AqueousMTENMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHSELSVGDLCSMIDQDAVHI
Ga0224503_1017666033300022201SedimentMTEHMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHDELSVGDLCSMIEQDAV
Ga0224502_1029135033300022218SedimentMTEHMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHDELSVGDLCSMIEQDAVHIDIGLKTMRERR
Ga0224501_1016671513300022223SedimentMTEHMTPLERWKELAIIENARMKRRLIGRDDMHAY
Ga0255758_1010963843300022928Salt MarshMTEHMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRK
Ga0255752_1040150013300022929Salt MarshMTESLTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPL
(restricted) Ga0233409_1013372113300022938SeawaterVTEHMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHDELSVGDLCSMI
(restricted) Ga0255040_1028777833300024059SeawaterVTEHMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWP
(restricted) Ga0255039_1003157513300024062SeawaterVTENLTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHDELSVGDLCSMIEQDAVHIDIG
Ga0228666_100060813300024221SeawaterVTENLTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHDELSVGDLCSMIEQDAVHI
Ga0228661_111724033300024266SeawaterMTESLTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHDELSVGDLCSMIEQDAVHIDI
Ga0228624_100130413300024313SeawaterVTEHMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKR
Ga0244775_1012247443300024346EstuarineMTEHLTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKR
Ga0244775_1027544473300024346EstuarineMTENLTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSR
(restricted) Ga0255049_1030025113300024517SeawaterMTEHMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHDELSVGDLCSMIEQ
(restricted) Ga0255048_1030186833300024518SeawaterMTENLTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHD
Ga0208667_101494373300025070MarineMTESLTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHDELSVGDLCSMIEQDAVHIDIGLKTMRER
Ga0208791_102576433300025083MarineMTEHLTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHGELSVGD
Ga0208792_1005203103300025085MarineMTESLTPLERWKELAIIENARMKRRLIGRDDMHAYAHK
Ga0208792_102858813300025085MarineMTEHMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKP
Ga0208793_111180643300025108MarineMTENLTPLERWKELAIIENARMKRRLIGRDVMHAYAYKPWPLEKLRKE
Ga0209232_121750833300025132MarineMTEHMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHGELSVGDLCSMIEQD
Ga0208148_100362613300025508AqueousMTENMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIK
Ga0208134_116009033300025652AqueousMTENMTPLERWKELAIIENARMKRRLIGRDDMHAYAHK
Ga0208428_108663923300025653AqueousMTEHMTPLERWKELAIIENARMKRRLIGRDDMHAYAYKPWPLEKLRKEIKRC
Ga0208898_109565713300025671AqueousMTESLTPLERWKELAIIENARMKRRLIGRDDMHAYAYKPWPLEKLRKEI
Ga0208899_116216713300025759AqueousMTEGLTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLR
Ga0208899_117959333300025759AqueousMTESLTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLR
Ga0208545_105459213300025806AqueousVTEHMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHGELSVGDLCSMIEQDAVHIDIGLKTM
Ga0208785_113875013300025815AqueousVTENMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHGELSVGDLCSMIEQDAVHI
Ga0208645_112317363300025853AqueousVTENMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHGELSVGDLCSMI
Ga0233395_101339613300026511SeawaterVTENLTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEK
Ga0208437_106213353300027525EstuarineMVEQITPLDRMKEMAAIENARMHRRMIGRDDMHAYMHKPWPMEHLRKAIAECLEKHGELSIGDLCSMI
(restricted) Ga0255054_1066099313300027856SeawaterVTEHMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRC
(restricted) Ga0233415_1007022943300027861SeawaterMTENLTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHDELSVGDLC
Ga0228619_101186813300028130SeawaterVTENLTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWP
Ga0228640_111238913300028273SeawaterMTEHMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLR
Ga0316201_1098464333300032136Worm BurrowMTEGLTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHDELSVGDLCSMIEQDAVHIDI
Ga0316203_117596233300032274Microbial MatVTENMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHGELSVGDLCSMIEQDAVHID
Ga0316202_1006174043300032277Microbial MatMTESLTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHNELS
Ga0316202_1013994513300032277Microbial MatMTEHMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIKRCLSRHNELS
Ga0316202_1056321713300032277Microbial MatVTENLTPLERWKELAIIENARMKRRLIGRDDMHAYAHK
Ga0316204_1054550613300032373Microbial MatMTENLTPLERWKELAIIENARMKRRLIGRDDMHAYAHK
Ga0348337_052866_3_2333300034418AqueousMTEHMTPLERWKELAIIENARMKRRLIGRDDMHAYAYKPWPLEKLRKEIKRCLSRHGELSVGDLCSMIEQDAVHIDI


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.