NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181353_1014928

Scaffold Ga0181353_1014928


Overview

Basic Information
Taxon OID3300022179 Open in IMG/M
Scaffold IDGa0181353_1014928 Open in IMG/M
Source Dataset NameFreshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)2006
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (71.43%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)43.2382Long. (o)-86.2805Alt. (m)Depth (m)8
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014613Metagenome / Metatranscriptome261Y
F017667Metagenome / Metatranscriptome239Y
F059096Metagenome / Metatranscriptome134N

Sequences

Protein IDFamilyRBSSequence
Ga0181353_10149281F017667GAGMSNYLDDYVSVQDRLKEFINAYPDYRIKTHILAESLVANCDVYIIKTELYRTEADAHPWTTGLSSESKSKQYALELAETGSLGRALNLAGYFAKTKPSAKKAIETTKPALAEFIKEQRPNDPEPIV
Ga0181353_10149282F059096GGAMTPAVWKVQSETPLRRAQVRFYCQPCADEAQNWPDGTFYSLKEQLDDAINDFAGREKLNVELP
Ga0181353_10149284F014613GAGMFPNLSDTQVFAIVVGVPFIGLYIWSLVTSAKAKAFNEGYKRGRSSVRYTEVLK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.