NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F059096

Metagenome / Metatranscriptome Family F059096

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F059096
Family Type Metagenome / Metatranscriptome
Number of Sequences 134
Average Sequence Length 64 residues
Representative Sequence MTPAVWKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLEDAINDFAGREKLNVELP
Number of Associated Samples 109
Number of Associated Scaffolds 134

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 41.79 %
% of genes near scaffold ends (potentially truncated) 62.69 %
% of genes from short scaffolds (< 2000 bps) 88.81 %
Associated GOLD sequencing projects 100
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (93.284 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake
(24.627 % of family members)
Environment Ontology (ENVO) Unclassified
(48.507 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(51.493 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 19.05%    β-sheet: 23.81%    Coil/Unstructured: 57.14%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 134 Family Scaffolds
PF09723Zn-ribbon_8 3.73
PF03354TerL_ATPase 1.49
PF09250Prim-Pol 0.75
PF12728HTH_17 0.75
PF13842Tnp_zf-ribbon_2 0.75
PF05065Phage_capsid 0.75
PF05869Dam 0.75
PF14279HNH_5 0.75
PF01170UPF0020 0.75
PF01844HNH 0.75

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 134 Family Scaffolds
COG4626Phage terminase-like protein, large subunit, contains N-terminal HTH domainMobilome: prophages, transposons [X] 1.49
COG011623S rRNA G2445 N2-methylase RlmLTranslation, ribosomal structure and biogenesis [J] 0.75
COG0286Type I restriction-modification system, DNA methylase subunitDefense mechanisms [V] 0.75
COG1041tRNA G10 N-methylase Trm11Translation, ribosomal structure and biogenesis [J] 0.75
COG109223S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmITranslation, ribosomal structure and biogenesis [J] 0.75
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 0.75
COG2263Predicted RNA methylaseGeneral function prediction only [R] 0.75
COG2264Ribosomal protein L11 methylase PrmATranslation, ribosomal structure and biogenesis [J] 0.75
COG2265tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD familyTranslation, ribosomal structure and biogenesis [J] 0.75
COG281316S rRNA G1207 or 23S rRNA G1835 methylase RsmC/RlmGTranslation, ribosomal structure and biogenesis [J] 0.75
COG2890Methylase of polypeptide chain release factorsTranslation, ribosomal structure and biogenesis [J] 0.75
COG4123tRNA1(Val) A37 N6-methylase TrmN6Translation, ribosomal structure and biogenesis [J] 0.75
COG4653Predicted phage phi-C31 gp36 major capsid-like proteinMobilome: prophages, transposons [X] 0.75


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.51 %
UnclassifiedrootN/A1.49 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001968|GOS2236_1036102All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi534Open in IMG/M
3300002161|JGI24766J26685_10008374All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi2827Open in IMG/M
3300002273|B570J29588_105136All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi760Open in IMG/M
3300002396|B570J29629_1018690All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi563Open in IMG/M
3300003393|JGI25909J50240_1019382All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi1577Open in IMG/M
3300003394|JGI25907J50239_1055646All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi798Open in IMG/M
3300003490|JGI25926J51410_1001678All Organisms → cellular organisms → Bacteria4387Open in IMG/M
3300003493|JGI25923J51411_1024593All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi1195Open in IMG/M
3300003499|JGI25930J51415_1032185All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi943Open in IMG/M
3300003499|JGI25930J51415_1044591All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi772Open in IMG/M
3300004125|Ga0066182_10171039All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi543Open in IMG/M
3300004797|Ga0007764_11536018All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi864Open in IMG/M
3300005417|Ga0068884_1558164All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi978Open in IMG/M
3300005525|Ga0068877_10067959All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi2299Open in IMG/M
3300005527|Ga0068876_10571851All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi614Open in IMG/M
3300005582|Ga0049080_10171288All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi723Open in IMG/M
3300005582|Ga0049080_10248100All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi581Open in IMG/M
3300005805|Ga0079957_1075462All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi1928Open in IMG/M
3300005940|Ga0073913_10016758All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi1031Open in IMG/M
3300005940|Ga0073913_10041285All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi716Open in IMG/M
3300006014|Ga0073919_1015982All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi691Open in IMG/M
3300006025|Ga0075474_10092926All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage980Open in IMG/M
3300006224|Ga0079037_100692506All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi995Open in IMG/M
3300006641|Ga0075471_10260579All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi889Open in IMG/M
3300006641|Ga0075471_10327139All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi777Open in IMG/M
3300006805|Ga0075464_10046028All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi2393Open in IMG/M
3300006805|Ga0075464_10288940All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi985Open in IMG/M
3300006805|Ga0075464_10556223All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi704Open in IMG/M
3300006863|Ga0075459_1009035All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi1627Open in IMG/M
3300006863|Ga0075459_1082346All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi550Open in IMG/M
3300006875|Ga0075473_10134714All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi988Open in IMG/M
3300006875|Ga0075473_10421204All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi539Open in IMG/M
3300006917|Ga0075472_10075666All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi1620Open in IMG/M
3300006919|Ga0070746_10114490All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi1336Open in IMG/M
3300006920|Ga0070748_1116327All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi1011Open in IMG/M
3300006930|Ga0079303_10109157All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi1051Open in IMG/M
3300007344|Ga0070745_1108770All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi1078Open in IMG/M
3300007346|Ga0070753_1232814All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi673Open in IMG/M
3300007538|Ga0099851_1153153All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi857Open in IMG/M
3300007541|Ga0099848_1049628All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi1694Open in IMG/M
3300007960|Ga0099850_1097213All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi1218Open in IMG/M
3300007972|Ga0105745_1269988All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi550Open in IMG/M
3300008114|Ga0114347_1213357All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi629Open in IMG/M
3300008116|Ga0114350_1146037All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi668Open in IMG/M
3300008122|Ga0114359_1025615All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi3292Open in IMG/M
3300008122|Ga0114359_1053503All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi1463Open in IMG/M
3300008266|Ga0114363_1218948All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi566Open in IMG/M
3300008266|Ga0114363_1237630All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi524Open in IMG/M
3300008448|Ga0114876_1168779All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi777Open in IMG/M
3300009169|Ga0105097_10210073All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi1072Open in IMG/M
3300009433|Ga0115545_1213552All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi655Open in IMG/M
3300010297|Ga0129345_1141427All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi873Open in IMG/M
3300010354|Ga0129333_11136520All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi651Open in IMG/M
3300012665|Ga0157210_1024351All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi965Open in IMG/M
3300013010|Ga0129327_10102977All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi1407Open in IMG/M
(restricted) 3300013122|Ga0172374_1140033All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi900Open in IMG/M
(restricted) 3300013131|Ga0172373_10212230All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi1307Open in IMG/M
3300017697|Ga0180120_10450784All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi502Open in IMG/M
3300017700|Ga0181339_1040203All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi509Open in IMG/M
3300017716|Ga0181350_1028377All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi1546Open in IMG/M
3300017716|Ga0181350_1139346All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi572Open in IMG/M
3300017774|Ga0181358_1092572All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi1091Open in IMG/M
3300017778|Ga0181349_1132968All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi908Open in IMG/M
3300017778|Ga0181349_1220453All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi647Open in IMG/M
3300017780|Ga0181346_1176359All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi785Open in IMG/M
3300019784|Ga0181359_1012613All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3060Open in IMG/M
3300019784|Ga0181359_1237734All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi561Open in IMG/M
3300019784|Ga0181359_1237908All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi561Open in IMG/M
3300020083|Ga0194111_10717215All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi613Open in IMG/M
3300020141|Ga0211732_1512935All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi924Open in IMG/M
3300020160|Ga0211733_10441809All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi1743Open in IMG/M
3300020161|Ga0211726_10871732All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi650Open in IMG/M
3300020200|Ga0194121_10372214All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi712Open in IMG/M
3300020501|Ga0208590_1017306All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi851Open in IMG/M
3300020528|Ga0208224_1050879All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi501Open in IMG/M
3300020558|Ga0208362_1000380All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage15045Open in IMG/M
3300021961|Ga0222714_10351872All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi791Open in IMG/M
3300022179|Ga0181353_1014928All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi2006Open in IMG/M
3300022179|Ga0181353_1139272All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi566Open in IMG/M
3300022190|Ga0181354_1054134All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi1335Open in IMG/M
3300022198|Ga0196905_1082359All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi875Open in IMG/M
3300022200|Ga0196901_1035269All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi1933Open in IMG/M
3300022200|Ga0196901_1086235All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi1112Open in IMG/M
3300022200|Ga0196901_1180344All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi687Open in IMG/M
3300022407|Ga0181351_1052312All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi1702Open in IMG/M
3300022407|Ga0181351_1100612All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi1117Open in IMG/M
3300023179|Ga0214923_10174208All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi1306Open in IMG/M
3300024262|Ga0210003_1395604All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi503Open in IMG/M
3300024490|Ga0255185_1050676All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi571Open in IMG/M
3300024500|Ga0255143_1012012All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi1468Open in IMG/M
3300025646|Ga0208161_1017255All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2791Open in IMG/M
3300025646|Ga0208161_1107772All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi757Open in IMG/M
3300025647|Ga0208160_1095783All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi776Open in IMG/M
3300025889|Ga0208644_1204621All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi854Open in IMG/M
3300026425|Ga0256300_1030839All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi753Open in IMG/M
3300026455|Ga0255155_1071141All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi572Open in IMG/M
3300027508|Ga0255072_1038610All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi989Open in IMG/M
3300027581|Ga0209651_1002205Not Available6938Open in IMG/M
3300027608|Ga0208974_1024245All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi1865Open in IMG/M
3300027659|Ga0208975_1121932All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi743Open in IMG/M
3300027688|Ga0209553_1049798All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi1652Open in IMG/M
3300027744|Ga0209355_1308308All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi597Open in IMG/M
3300027785|Ga0209246_10191548All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi800Open in IMG/M
3300027793|Ga0209972_10014363Not Available5116Open in IMG/M
3300027805|Ga0209229_10063585All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi1652Open in IMG/M
3300027816|Ga0209990_10132464All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi1191Open in IMG/M
3300027885|Ga0209450_11026809All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi583Open in IMG/M
3300027887|Ga0208980_10475615All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi717Open in IMG/M
3300027892|Ga0209550_10276767All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi1093Open in IMG/M
(restricted) 3300027970|Ga0247837_1282053All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi636Open in IMG/M
(restricted) 3300028114|Ga0247835_1052892All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi1780Open in IMG/M
3300031673|Ga0307377_10272323All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi1291Open in IMG/M
3300031758|Ga0315907_10882197All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi658Open in IMG/M
3300031758|Ga0315907_10970764All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi616Open in IMG/M
3300031758|Ga0315907_11155934All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi545Open in IMG/M
3300031787|Ga0315900_10071457All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi3526Open in IMG/M
3300031787|Ga0315900_10686357All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi728Open in IMG/M
3300031857|Ga0315909_10819515All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi585Open in IMG/M
3300031857|Ga0315909_11010155All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi501Open in IMG/M
3300031951|Ga0315904_10059965All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4188Open in IMG/M
3300031951|Ga0315904_10246753All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi1713Open in IMG/M
3300031963|Ga0315901_10039752All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4704Open in IMG/M
3300032093|Ga0315902_11259728All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi525Open in IMG/M
3300032116|Ga0315903_10084814All Organisms → cellular organisms → Bacteria3075Open in IMG/M
3300032116|Ga0315903_10714948All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi746Open in IMG/M
3300033418|Ga0316625_102729963All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi504Open in IMG/M
3300033981|Ga0334982_0154472All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1166Open in IMG/M
3300034021|Ga0335004_0167111All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi1403Open in IMG/M
3300034061|Ga0334987_0278662All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi1121Open in IMG/M
3300034062|Ga0334995_0186537All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi1457Open in IMG/M
3300034071|Ga0335028_0098304All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi1920Open in IMG/M
3300034120|Ga0335056_0144066All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi1422Open in IMG/M
3300034121|Ga0335058_0452526All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi732Open in IMG/M
3300034280|Ga0334997_0501293All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi759Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake24.63%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous19.40%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater9.70%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater9.70%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton4.48%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater3.73%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater3.73%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic2.99%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient2.99%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.24%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.24%
SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sand2.24%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment1.49%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.75%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.75%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.75%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.75%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.75%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface0.75%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.75%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.75%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.75%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.75%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine0.75%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.75%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.75%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface0.75%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001968Marine microbial communities from Lake Gatun, Panama - GS020EnvironmentalOpen in IMG/M
3300002161Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USAEnvironmentalOpen in IMG/M
3300002273Freshwater microbial communities from Lake Mendota, WI - 29JUN2012 deep hole epilimnionEnvironmentalOpen in IMG/M
3300002396Freshwater microbial communities from Lake Mendota, WI - 13OCT2010 deep hole epilimnionEnvironmentalOpen in IMG/M
3300003393Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DDEnvironmentalOpen in IMG/M
3300003394Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SNEnvironmentalOpen in IMG/M
3300003490Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SNEnvironmentalOpen in IMG/M
3300003493Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SNEnvironmentalOpen in IMG/M
3300003499Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DNEnvironmentalOpen in IMG/M
3300004125Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (version 2)EnvironmentalOpen in IMG/M
3300004797Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005417Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005525Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaGEnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005582Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRFEnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300005940Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14EnvironmentalOpen in IMG/M
3300006014Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T3_25-Nov-14EnvironmentalOpen in IMG/M
3300006025Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006224Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaGEnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300006863Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNAEnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006917Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300006930Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWCEnvironmentalOpen in IMG/M
3300007344Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4EnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300007960Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaGEnvironmentalOpen in IMG/M
3300007972Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0umEnvironmentalOpen in IMG/M
3300008114Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NAEnvironmentalOpen in IMG/M
3300008116Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NAEnvironmentalOpen in IMG/M
3300008122Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample HABS-E2014-0124-100-LTREnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008448Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigsEnvironmentalOpen in IMG/M
3300009169Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300009433Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330EnvironmentalOpen in IMG/M
3300010297Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNAEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300012665Freshwater microbial communities from Talbot River, Ontario, Canada - S11EnvironmentalOpen in IMG/M
3300013010Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNAEnvironmentalOpen in IMG/M
3300013122 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3mEnvironmentalOpen in IMG/M
3300013131 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10mEnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017700Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.D.DEnvironmentalOpen in IMG/M
3300017716Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.DEnvironmentalOpen in IMG/M
3300017774Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017778Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017780Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020083Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300mEnvironmentalOpen in IMG/M
3300020141Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1EnvironmentalOpen in IMG/M
3300020160Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1EnvironmentalOpen in IMG/M
3300020161Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1EnvironmentalOpen in IMG/M
3300020200Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50mEnvironmentalOpen in IMG/M
3300020501Freshwater microbial communities from Lake Mendota, WI - 27SEP2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020528Freshwater microbial communities from Lake Mendota, WI - 26OCT2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020558Freshwater microbial communities from Lake Mendota, WI - 13OCT2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300022179Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.NEnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300022198Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022200Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022407Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300023179Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510EnvironmentalOpen in IMG/M
3300024262Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300024490Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepB_0hEnvironmentalOpen in IMG/M
3300024500Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0hEnvironmentalOpen in IMG/M
3300025646Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025647Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300026425Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026455Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8hEnvironmentalOpen in IMG/M
3300027508Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8hEnvironmentalOpen in IMG/M
3300027581Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027608Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027659Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027688Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027744Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027785Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027793Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027805Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)EnvironmentalOpen in IMG/M
3300027816Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027885Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes)EnvironmentalOpen in IMG/M
3300027887Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 BulkEnvironmentalOpen in IMG/M
3300027892Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027970 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14.5mEnvironmentalOpen in IMG/M
3300028114 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_13.5mEnvironmentalOpen in IMG/M
3300031673Soil microbial communities from Risofladan, Vaasa, Finland - TR-3EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300032093Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300033418Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_AEnvironmentalOpen in IMG/M
3300033981Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011EnvironmentalOpen in IMG/M
3300034021Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057EnvironmentalOpen in IMG/M
3300034061Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028EnvironmentalOpen in IMG/M
3300034062Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045EnvironmentalOpen in IMG/M
3300034071Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110EnvironmentalOpen in IMG/M
3300034120Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172EnvironmentalOpen in IMG/M
3300034121Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174EnvironmentalOpen in IMG/M
3300034280Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
GOS2236_103610223300001968MarineSNKGEWHPMAQTPAVWVCISESPKRKGITRFYCQKCADDVQNWTDNTFYLLREQLQDAIKNFAEQEKLDVELP*
JGI24766J26685_1000837463300002161Freshwater And SedimentMTPAVWKVQSETPLRKAQVRFYCQPCADEVQNWPDGTFYSXKEXLDDAIXXFAGREKLNVELP*
B570J29588_10513623300002273FreshwaterSETPLRKAQVRFYCQACADDSQNWPDGTFYSLKEQLEDAINQFAGREKLDVELPR*
B570J29629_101869023300002396FreshwaterMTPAVWKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLEDAISDFAGREKLDVELPR*
JGI25909J50240_101938233300003393Freshwater LakeMTPAVWKVQSETPLRKAQVRFYCQPCADEVQNWPDGTFYSLKEQLEDAINDFAGREKLDVELPR*
JGI25907J50239_105564623300003394Freshwater LakeMINDAAERAEVPRPAVWKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYTLKEQLNDAIXDFA
JGI25926J51410_1001678103300003490Freshwater LakeMTPAVWKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLDDAINNFAGREKLNVELP*
JGI25923J51411_102459343300003493Freshwater LakeMTPAVWKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLDDAISNFAGREKLNVELP*
JGI25930J51415_103218513300003499Freshwater LakeMTPAVWKVQSETPLRKAQVRFYCQPCADDVQNWPDGTFYSLKEQLEDAINDFAGREKLNVELP*
JGI25930J51415_104459113300003499Freshwater LakeMTPAVWKVQSETPLRKAQVRFYCQPCADDVQNWPDGTFYSLKEQLEDAINDFAGREKLDVELP*
Ga0066182_1017103913300004125Freshwater LakeGWDLRAMTPAVWKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLDDAINNFAGREKLNVELP*
Ga0007764_1153601813300004797Freshwater LakeMTPAVWKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLDDAISNFAGREK
Ga0068884_155816423300005417Freshwater LakeMTPAVWKVQSETPLRKAQVRFYCQPCADEVQNWPDGTFYSLKEQLDDAINDFAGREKLDVELP*
Ga0068877_1006795923300005525Freshwater LakeMTPAVWKVQSETPLRKAQVRFYCQPCADDVQNWPDGTFYSLKEQLEDAISDFAGREKLDVELP*
Ga0068876_1057185123300005527Freshwater LakeMTPAVWKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLEDAINDFAGREKLNVELP*
Ga0049080_1017128823300005582Freshwater LenticMINDAAETAEVPRPAVWKVQSETPLRKAQVRFYCQPCADDAQNWPDGTFYLLKEQLEDAINDFAGREKLDVELPR*
Ga0049080_1024810013300005582Freshwater LenticPAVWKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLEDAINDFAGREKLNVELP*
Ga0079957_107546213300005805LakeMTPAVWKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLDDAISDFAGREKLDVELPR*
Ga0073913_1001675833300005940SandPAVWKVQSETPLRKAQVRFYCQPCADDAQNWPDGTFYSLKEQLEDAINDFAGREKLDVQLPR*
Ga0073913_1004128523300005940SandPAVWKVQSETPLRKAQVRFYCQPCADDAQNWPDGTFYSLKEQLEDAINDFAGREKLDVELPR*
Ga0073919_101598213300006014SandTTPAVWKVQSETPLRKAQVRFYCQPCADDAQNWPDGTFYSLKEQLEDAINDFAGREKLDVELPR*
Ga0075474_1009292613300006025AqueousPAVWKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLQDALKDTAQREMINVELP*
Ga0079037_10069250623300006224Freshwater WetlandsMTPAVWKVQSETPLRKAQVRFYCQPCADEVQNWPDGTFYSLKEQLEDAINDFAGREKLNVELP*
Ga0075471_1026057933300006641AqueousSETPIRKAQVRFYCQPCADEVQNWPDGTFWSLKEQLEMAIDEFAGREKLNVELP*
Ga0075471_1032713913300006641AqueousAMTPAVWKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLEDAIDQFAGREKLDVELP*
Ga0075464_1004602833300006805AqueousMTPAVWKVQSETPLRKAQVRFYCQPCADEVQNWPDGTFYSLKEQLDDAINDFAGREKLNVELP*
Ga0075464_1028894033300006805AqueousWHLKAQTPAVWKVQSETPIRKAQVRFYCQPCADEVQNWPDGTFWSLKEQLEMAIDEFAGREKLNVELP*
Ga0075464_1055622313300006805AqueousMKDGTWHLKAQTPAVWKVQSETPIRKAQVRFYCQPCADEVQNWPDGTFWSLKEQLEMAIDEFAG
Ga0075459_100903513300006863AqueousQSPAVWKVQSETPIRRAQVRFYCQPCANEVQNWPDGTFWSLKEQLDYAIEQFAGSEKLNVELP*
Ga0075459_108234613300006863AqueousDLRTTTPAVWKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLEDAINQFAGREKLDVELP*
Ga0075473_1013471413300006875AqueousKDGTWHLKAQTPAVWKVQSETPIRKAQVRFYCQPCADEVQNWPDGTFWSLKEQLEMAIDEFAGREKLNVELP*
Ga0075473_1042120413300006875AqueousKDGTWHLKAQTPAVWKVQSETPIRKAQVRFYCQPCADEVQNWPDGTFWSLKEQLESAIDEFAGREKLNVELP*
Ga0075472_1007566653300006917AqueousPAVWKVQSETPIRRAQVRFYCQPCANEVQNWPDGTFWSLKEQLDYAIEQFAGSEKLNVELP*
Ga0070746_1011449023300006919AqueousMTPAVWKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLENAINDFAGREKLDVELP*
Ga0070748_111632713300006920AqueousMTPAVWKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLEDAIDQFAGREKLDVELP*
Ga0079303_1010915723300006930Deep SubsurfaceMTPAVWKVQSETPLRKAQVRFYCQPCADESQNWPDGTFYSLKEQLDDAISNFAGREKLNVELP*
Ga0070745_110877013300007344AqueousMTPAVWKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLEDAINDFAGREKLDV
Ga0070753_123281413300007346AqueousAQTPAVWKVQSETPIRKAQVRFYCQPCADEVQNWPDGTFWSLKEQLEMAIDEFAGREKLNVELP*
Ga0099851_115315313300007538AqueousMSPAVWKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLEDAINDFAGREKLDVELP*
Ga0099848_104962853300007541AqueousMTPAVWKVQSETPLRKAQVRFYCQPCADEVQNWPDGTFYSLKEQLEDAINQFAGREKLNVELP*
Ga0099850_109721313300007960AqueousNGWDLRATTPAVWKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLEDAINQFAGREKLDVELP*
Ga0105745_126998823300007972Estuary WaterDLRATTPAVWKVQSETPLRKAQVRFYCQPCADDAQNWPDGTFYSLKEQLEDAINDFAGREKLDVELPR*
Ga0114347_121335713300008114Freshwater, PlanktonGWDLRAMTPAVWKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLEDAINDFAGREKLNVELP*
Ga0114350_114603723300008116Freshwater, PlanktonMTPAVWKVQSETPLRKAQVRFYCQPCADDVQNWPDGTFYSLKEQLQDAISDFAGREKLDVELP*
Ga0114359_102561553300008122Freshwater, PlanktonMTPAVWKVQSETPLRKAQVRFYCQPCADDVQNWPDGTFYSLKEQLQDAINDFAGREKLDVELP*
Ga0114359_105350343300008122Freshwater, PlanktonRWGANKNGWDLRAMTPAVWKVQSETPLRKAQVRFYCQPCADDVQNWPDGTFYSLKEQLDDAISNFAGREKLNVELP*
Ga0114363_121894813300008266Freshwater, PlanktonAVWKVQSETPIRRAQVRFYCQPCANEVQNWPDGTFWSLKEQLEAAIDDFAGREKLNVELP
Ga0114363_123763013300008266Freshwater, PlanktonMTPAVWKVQSETPLRKAQVRFYCQPCADDVQNWPDGTFYSLKEQLEDAISDFAGREKLD
Ga0114876_116877923300008448Freshwater LakeMTPAVWKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLDDAINDFAGREKLNVELP*
Ga0105097_1021007313300009169Freshwater SedimentLKDGSWHLKAQVPAVWKVQSETPTRRTQVRFYCQACANEAQNWPDGTFWSLREQLTYAIDQFAGREKLDVELP*
Ga0115545_121355223300009433Pelagic MarineGWDLRAMTPAVWKVQSETPLRKAQVRFYCQPCADDVQNWPDGTFYSLKEQLEDAINDFAGREKLDVQLP*
Ga0129345_114142723300010297Freshwater To Marine Saline GradientVVVNDAGEKAEVPRPAVWKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLEDAINDFAGREKLDVELP*
Ga0129333_1113652023300010354Freshwater To Marine Saline GradientMTPAVWKVQSETPLRKAQVRFYCQPCADEVQNWPDGTFYSLKEQLDDAISNFAGREKLNVELP*
Ga0157210_102435133300012665FreshwaterATTPAVWKVQSETPLRKAQVRFYCQPCADDAQNWPDGTFYSLKEQLEDAINDFAGREKLDVELPR*
Ga0129327_1010297733300013010Freshwater To Marine Saline GradientMTPAVWKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLEDAINQFAGREKLDVELP*
(restricted) Ga0172374_114003313300013122FreshwaterSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLQDAINDFAGREKLDVELP*
(restricted) Ga0172373_1021223043300013131FreshwaterWDIRATTPAVWKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLQDAINDFAGREKLDVELP*
Ga0180120_1045078423300017697Freshwater To Marine Saline GradientMTPAVWKVQSETPLRRAQVRFYCQPCADEAQNWPDGTFYSLKEQLEDAINDFAG
Ga0181339_104020323300017700Freshwater LakeMTPAVWKVQSETPLRKAQVRFYCQPCADDAQNWPDGTFYSLKEQLEDAINDFAGREKLNVELP
Ga0181350_102837733300017716Freshwater LakeMINDAAERAEVPRPAVWKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLDDAISDFAGREKLDVELPR
Ga0181350_113934613300017716Freshwater LakeGQNKNGWDLRATTPGVWKVQSETPIRKAQVRFYCQPCADDAQNWPDGTFYSLKEQLEDAINDFAGREKLDVELPR
Ga0181358_109257213300017774Freshwater LakeNKNGWDLRATTPAVWKVQSETPLRKAQVRFYCQPCADDAQNWPDGTFYSLKEQLQDAINDFAGREKLDVELPR
Ga0181349_113296833300017778Freshwater LakeMTPAVWKVQSETPLRKAQVRFYCQPCADDVQNWPDGTFYSLKEQLEDAINDFAGREKLD
Ga0181349_122045313300017778Freshwater LakeARTPAVWKVQSETPLRKAQVRFYCQPCADEVQNWPDGTFYSLKEQLEDAINNFAGREKLNVELPR
Ga0181346_117635923300017780Freshwater LakeLRAMTPAVWKVQSETPLRKAQVRFYCQPCADEVQNWPDGTFYSLKEQLEDAINQFAGREKLNVELP
Ga0181359_101261383300019784Freshwater LakeMTPAVWKVQSETPLRKGQVRFYCQPCADEAQNWPDGTFYSLKEQLEDAISDFAGREKLDVELPR
Ga0181359_123773423300019784Freshwater LakeAVWKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLDDAINNFAGREKLNVELP
Ga0181359_123790813300019784Freshwater LakeQNKNGWDLRATTPAVWKVQSETPLRKAQVRFYCQPCADDAQNWPDGTFYSLKEQLEDAINDFAGREKLDVELPR
Ga0194111_1071721523300020083Freshwater LakeYRWGQNKGVWDIRATTPAVWKVQSETPMRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLQDAINYFAGREKLNVKLP
Ga0211732_151293523300020141FreshwaterMTPAVWKVQSETPLRKAQVRFYCQPCADDVQNWPDGTFYSLKEQLEDAINDFAGREKLDVELP
Ga0211733_1044180963300020160FreshwaterMTPAVWKVQSETPLRKAQVRFYCQPCADDVQNWPDGTFYSLKEQLEDAINDFAGREKLDVQLP
Ga0211726_1087173213300020161FreshwaterMTPAVWKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLEDAINDFAGREKLDVQLP
Ga0194121_1037221413300020200Freshwater LakeVESETPMRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLQDAINHFAGREKLNVKLP
Ga0208590_101730613300020501FreshwaterMTPAVWKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLDDAISNFAGREKLNV
Ga0208224_105087913300020528FreshwaterDLRAMTPAVWKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLEDAINDFAGREKLDVELPR
Ga0208362_100038063300020558FreshwaterMTPAVWKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLEDAISDFAGREKLDVELPR
Ga0222714_1035187223300021961Estuarine WaterMTPAVWKVQSETPLRKAQVRFYCQPCADDAQNWPDGTFYSLKEQLEDAINQFAGREKLDVELPR
Ga0181353_101492823300022179Freshwater LakeMTPAVWKVQSETPLRRAQVRFYCQPCADEAQNWPDGTFYSLKEQLDDAINDFAGREKLNVELP
Ga0181353_113927223300022179Freshwater LakeMTPAVWKVQSETPLRKAQVRFYCQPCADEVQNWPDGTFYSLKEQLDDAISNFAGREKLNVELP
Ga0181354_105413413300022190Freshwater LakeGANKNGWDLRAMTPAVWKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLEDAINNFAGREKLNVELP
Ga0196905_108235923300022198AqueousMTPAVWKVQSETPLRKAQVRFYCQPCADEVQNWPDGTFYSLKEQLEDAINQFAGREKLDVELP
Ga0196901_103526963300022200AqueousVVVNDAGEKAEVPRPAVWKVQSETPLRKAQVRFYCQPCADDAQNWPDGTFYSLKEQLEDAINQFAGREKLDVELPR
Ga0196901_108623513300022200AqueousMTPAVWKVQSETPLRKAQVRFYCQPCADEVQNWPDGTFYSLKEQLEDAINDFAGREKLN
Ga0196901_118034413300022200AqueousTPAVWKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLEDAINDFAGREKLDVELP
Ga0181351_105231213300022407Freshwater LakeQSETPLRKAQVRFYCQPCADDAQNWPDGTFYSLKEQLEDAINDFAGREKLDVELPR
Ga0181351_110061233300022407Freshwater LakeATTPAVWKVQSETPLRKAQVRFYCQPCADDAQNWPDGTFYSLKEQLEDAINDFAGREKLDVELPR
Ga0214923_1017420833300023179FreshwaterKYRSGANKNGWDLRAMTPAVWKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLDDAISNFAGREKLNVELP
Ga0210003_139560413300024262Deep SubsurfaceNGWDLRATTPAVWKVQSETPLRKAQVRFYCQPCADDAQNWPDGTFYSLKEQLEDAINDFAGREKLDVELP
Ga0255185_105067623300024490FreshwaterWGANKNGWDLRAMTPAVWKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLDDAISNFAGREKLNVELP
Ga0255143_101201213300024500FreshwaterHPLAQSPAVWKVQSETPIRRAQVRFYCQPCANEVQNWPDGTFWSLKEQLDYAIEQFAGSEKLNVELP
Ga0208161_101725583300025646AqueousKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLEDAINDFAGREKLNVELP
Ga0208161_110777223300025646AqueousMTPAVWKVQSETPLRKAQVRFYCQPCADEVQNWPDGTFYSLKEQLEDAINQFAGREKLNVELP
Ga0208160_109578323300025647AqueousMTPAVWKVQSETPLRKAQVRFYCQPCANEAQNWPDGTFYSLKEQLDDAISNFAGREKLNVELP
Ga0208644_120462123300025889AqueousMTPAVWKVQSETPLRKAQVRFYCQPCADDAQNWPDGTFYSLKEQLEDAINDFAGREKLDVELP
Ga0256300_103083923300026425FreshwaterWHLKARTPAVWKVQSETPTRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLEDAINDFAGREKLDVELPR
Ga0255155_107114113300026455FreshwaterKVQSETPIRRAQVRFYCQPCANEVQNWPDGTFWSLKEQLDYAIEQFAGSEKLNVELP
Ga0255072_103861013300027508FreshwaterETPLRKAQVRFYCQPCANEAQNWPDGTFYSLKEQLDDAISHFAGREKLDVELPR
Ga0209651_100220583300027581Freshwater LakeMTPAVWKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLDDAINNFAGREKLNVELP
Ga0208974_102424563300027608Freshwater LenticMINDAAETAEVPRPAVWKVQSETPLRKAQVRFYCQPCADDAQNWPDGTFYLLKEQLEDAINDFAGREKLDVELPR
Ga0208975_112193213300027659Freshwater LenticAVWKVQSETPLRKAQVRFYCQPCADDAQNWPDGTFYSLKEQLEDAINDFAGREKLDVELP
Ga0209553_104979863300027688Freshwater LakeMTPAVWKVQSETPLRKAQVRFYCQPCADDVQNWPDGTFYSLKEQLEDAINDFAGREKLDVELPR
Ga0209355_130830813300027744Freshwater LakeGWDLRATTPAVWKVQSETPIRKAQVRFYCQPCADDAQNWPDGTFYSLKEQLEDAINDFAGREKLDVELPR
Ga0209246_1019154823300027785Freshwater LakeMTPAVWKVQSETPLRKAQVRFYCQPCADEVQNWPDGTFYSLKEQLNDAISNFAGREKLDVELP
Ga0209972_1001436363300027793Freshwater LakeMTPAVWKVQSETPLRKAQVRFYCQPCADEVQNWPDGTFYSLKEQLDDAINDFAGREKLDVELP
Ga0209229_1006358513300027805Freshwater And SedimentPAVWKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLDDAISDFAGREKLDVELPR
Ga0209990_1013246423300027816Freshwater LakeMTPAVWKVQSETPLRKAQVRFYCQPCADDVQNWPDGTFYSLKEQLEDAISDFAGREKLDVELP
Ga0209450_1102680923300027885Freshwater Lake SedimentDLRAMTPAVWKVQSETPLRKAQVRFYCQPCADEVQNWPDGTFYSLKEQLDDAINDFAGREKLNVELP
Ga0208980_1047561523300027887WetlandMTPAVWKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLDDAISDFAGREKLDVELPR
Ga0209550_1027676723300027892Freshwater LakeMTPAVWKVQSETPLRKAQVRFYCQPCADDAQNWPDGTFYSLKEQLEDAINDFAGREKLDVELPR
(restricted) Ga0247837_128205323300027970FreshwaterKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLENAINDFAGREKLDVELP
(restricted) Ga0247835_105289213300028114FreshwaterAVWKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLEDAINDFAGREKLDVELP
Ga0307377_1027232343300031673SoilVVVNDAGEKAEVPRPAVWKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLEDAINDFAGREKLDVELP
Ga0315907_1088219723300031758FreshwaterMTPAVWKVQSETPLRKAQVRFYCQPCADDVQNWPDGTFYSLKEQLEDAISDFAGREKLDVQLP
Ga0315907_1097076413300031758FreshwaterMTPAVWKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLEDAINDFAGREKL
Ga0315907_1115593413300031758FreshwaterGWDLRAMTPAVWKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLEDAINDFAGREKLNVELP
Ga0315900_1007145753300031787FreshwaterMTPAVWKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLEDAISNFAGREKLNVELP
Ga0315900_1068635723300031787FreshwaterMTPAVWKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLEDAISDFAGREKLDVELP
Ga0315909_1081951513300031857FreshwaterPAVWKVQSETPLRKAQVRFYCQPCADDAQNWPDGTFYSLKEQLEDAINDFAGREKLDVQLPR
Ga0315909_1101015513300031857FreshwaterMTPAVWKVQSETPLRKAQVRFYCQPCADEVQNWPDGTFYSLKEQLDDAINDFAGREK
Ga0315904_1005996583300031951FreshwaterLRAMTPAVWKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLDDAISNFAGREKLNVELP
Ga0315904_1024675313300031951FreshwaterVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLEDAISDFAGREKLDVQLP
Ga0315901_1003975293300031963FreshwaterQSETPLRKAQVRFYCQPCADDVQNWPDGTFYSLKEQLEDAINDFAGREQLDVELPR
Ga0315902_1125972823300032093FreshwaterETPLRKAQVRFYCQPCADDAQNWPDGTFYSLKEQLEDAINDFAGREKLDVELPR
Ga0315903_1008481473300032116FreshwaterRYGQMKDGTWHLKAQTPAVWKVQSETPIRKAQVRFYCQPCADEVQNWPDGTFWSLKEQLEMAIDEFAGREKLNVELP
Ga0315903_1071494813300032116FreshwaterETPLRKAQVRFYCQPCADDAQNWPDGTFYSLKEQLEDAINDFAGREQLDVELPR
Ga0316625_10272996323300033418SoilAVWKVQSETPTRRAQVRFYCQACANEAQNWPDGTFWSLKEQLTYAIDQFAGREKLDVELP
Ga0334982_0154472_3_1883300033981FreshwaterAVWKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLDDAISDFAGREKLDVELP
Ga0335004_0167111_1_1923300034021FreshwaterTPAVWKVQSETPLRKAQVRFYCQPCADDAQNWPDGTFYSLKEQLEDAINDFAGREKLDVELPR
Ga0334987_0278662_956_11203300034061FreshwaterSTPLRKAQVRFYCQPCADDAQNWPDGTFYSLKEQLEDAINDFAGREKLDVELPR
Ga0334995_0186537_1292_14563300034062FreshwaterETPLRKAQVRFYCQPCADDAQNWPDGTFYSLKEQLEDAINQFAGREKLDVELPR
Ga0335028_0098304_1753_19203300034071FreshwaterMTPAVWKVQSETPLRKAQVRFYCQPCADEVQNWPDGTFYSLKEQLDDAISNFAGRE
Ga0335056_0144066_1190_14203300034120FreshwaterWGQQKGEWHIKARTPAVWKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLDDAISDFAGREKLDVELPR
Ga0335058_0452526_1_2163300034121FreshwaterGEWHIKARTPAVWKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLDDAISDFAGREKLDVELPR
Ga0334997_0501293_549_7583300034280FreshwaterWDLRATTPAVWKVQSETPLRKAQVRFYCQPCADDAQNWPDGTFYSLKEQLEDAINQFAGREKLDVELPR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.