NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0196903_1001145

Scaffold Ga0196903_1001145


Overview

Basic Information
Taxon OID3300022169 Open in IMG/M
Scaffold IDGa0196903_1001145 Open in IMG/M
Source Dataset NameFreshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3825
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)13 (86.67%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location
Location NameUSA: Chesapeake Bay
CoordinatesLat. (o)37.1Long. (o)-76.0972Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021020Metagenome / Metatranscriptome221Y
F042350Metagenome / Metatranscriptome158Y
F076122Metagenome / Metatranscriptome118Y
F090460Metagenome / Metatranscriptome108Y

Sequences

Protein IDFamilyRBSSequence
Ga0196903_100114511F090460AGGAGMINDKFSDKEYWQGVLETCEYFRDELGFEDATDTSLYQQATEELALV
Ga0196903_100114515F021020AGGAGMSETISLNNSIVTNNYDLNIWDRRGYETEYQEEGWEISVYQYPYIGASYGSGTFMEDLTITLTPTETKRLTLGWGPDLGGDYCEDSDFWLDKDTFFQTYTDIPERVAGLLKALPEYEQIDAFR
Ga0196903_10011452F076122N/AMAKHEVVNEILEYLDERRHEISNEMGMFVEEGSNDYIELAAMFDVYDHLITKLEDDYR
Ga0196903_10011457F042350GGAMPGRESDYERGFIRGVSAMMNLISSDKVKRLDKSNVLQYARELVEAQKEETNVPQR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.