Scaffold Ga0232645_1172847

Overview

Basic Information

• Taxon OID: 3300021974
• Scaffold ID: Ga0232645_1172847
• Source Dataset Name: Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Perseverance_FS929 _150kmer
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Marine Biological Laboratory
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 687
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium ADurb.Bin331 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids → Characterization Of Microbial Community From Mariana Back Arc

Source Dataset Sampling Location

• Location Name: Perseverance vent field, Mariana back arc basin
• Coordinates
  • Lat. (^o): 15.47990499
  • Long. (^o): 144.50763029
  • Depth (m): 3912

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077283	Metagenome / Metatranscriptome	117	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0232645_11728471	F077283	GAG	MSNAEQVAHEKMLRDCENSMFGGDVHDVETPVHVWIDAKRESPIVAQMVWVAVPNVVTCRYQVILCYMDSDEQWRDAGGVLMFRRVSFWQYADVPECEVLC