NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0222713_10104010

Scaffold Ga0222713_10104010


Overview

Basic Information
Taxon OID3300021962 Open in IMG/M
Scaffold IDGa0222713_10104010 Open in IMG/M
Source Dataset NameEstuarine water microbial communities from San Francisco Bay, California, United States - C33_649D
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2030
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (71.43%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water → Estuarine Microbial Communities From The San Francisco Bay-Delta (Sfbd), California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)38.06Long. (o)-121.8Alt. (m)Depth (m)12
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F050377Metagenome / Metatranscriptome145Y
F066789Metagenome / Metatranscriptome126Y
F095358Metagenome / Metatranscriptome105Y

Sequences

Protein IDFamilyRBSSequence
Ga0222713_101040103F066789GGAMTCTKYGCNYELDLDGQVTCTVCGSMDDDKEPVNIFETQMDFE
Ga0222713_101040105F050377AGGAMSTPTTTREYLKAQGITVGKRGRFSAAAKNAIAEAAKKGVVFTDGKNVK
Ga0222713_101040107F095358N/ADKFWEDVDGFGLSMDSGGDIIEEVIRDWMRDNDFLVSLDEDGWLDD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.