Basic Information | |
---|---|
Family ID | F066789 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 126 |
Average Sequence Length | 47 residues |
Representative Sequence | MTCTKYGCDYQLDLDGQVTCAVCGAMDDDKQPVDIFETQVDFE |
Number of Associated Samples | 78 |
Number of Associated Scaffolds | 126 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 55.65 % |
% of genes near scaffold ends (potentially truncated) | 17.46 % |
% of genes from short scaffolds (< 2000 bps) | 62.70 % |
Associated GOLD sequencing projects | 62 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.27 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (42.857 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (23.016 % of family members) |
Environment Ontology (ENVO) | Unclassified (61.905 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (70.635 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.90% β-sheet: 9.86% Coil/Unstructured: 73.24% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 126 Family Scaffolds |
---|---|---|
PF01844 | HNH | 3.97 |
PF13640 | 2OG-FeII_Oxy_3 | 3.97 |
PF04488 | Gly_transf_sug | 3.17 |
PF12849 | PBP_like_2 | 3.17 |
PF01521 | Fe-S_biosyn | 3.17 |
PF01458 | SUFBD | 2.38 |
PF06067 | DUF932 | 2.38 |
PF09834 | DUF2061 | 1.59 |
PF00685 | Sulfotransfer_1 | 1.59 |
PF14025 | DUF4241 | 1.59 |
PF00692 | dUTPase | 0.79 |
PF00210 | Ferritin | 0.79 |
PF00082 | Peptidase_S8 | 0.79 |
PF16861 | Carbam_trans_C | 0.79 |
PF02075 | RuvC | 0.79 |
PF01391 | Collagen | 0.79 |
PF04973 | NMN_transporter | 0.79 |
PF01370 | Epimerase | 0.79 |
PF11397 | GlcNAc | 0.79 |
PF05118 | Asp_Arg_Hydrox | 0.79 |
PF00296 | Bac_luciferase | 0.79 |
PF02675 | AdoMet_dc | 0.79 |
PF02811 | PHP | 0.79 |
PF02668 | TauD | 0.79 |
PF00356 | LacI | 0.79 |
PF13155 | Toprim_2 | 0.79 |
PF00255 | GSHPx | 0.79 |
PF07733 | DNA_pol3_alpha | 0.79 |
PF02945 | Endonuclease_7 | 0.79 |
PF00583 | Acetyltransf_1 | 0.79 |
PF01121 | CoaE | 0.79 |
COG ID | Name | Functional Category | % Frequency in 126 Family Scaffolds |
---|---|---|---|
COG0316 | Fe-S cluster assembly iron-binding protein IscA | Posttranslational modification, protein turnover, chaperones [O] | 3.17 |
COG3774 | Mannosyltransferase OCH1 or related enzyme | Cell wall/membrane/envelope biogenesis [M] | 3.17 |
COG4841 | Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family | Function unknown [S] | 3.17 |
COG0719 | Fe-S cluster assembly scaffold protein SufB | Posttranslational modification, protein turnover, chaperones [O] | 2.38 |
COG0237 | Dephospho-CoA kinase | Coenzyme transport and metabolism [H] | 0.79 |
COG0386 | Thioredoxin/glutathione peroxidase BtuE, reduces lipid peroxides | Defense mechanisms [V] | 0.79 |
COG0587 | DNA polymerase III, alpha subunit | Replication, recombination and repair [L] | 0.79 |
COG0717 | dCTP deaminase | Nucleotide transport and metabolism [F] | 0.79 |
COG0756 | dUTP pyrophosphatase (dUTPase) | Defense mechanisms [V] | 0.79 |
COG0817 | Holliday junction resolvasome RuvABC endonuclease subunit RuvC | Replication, recombination and repair [L] | 0.79 |
COG1586 | S-adenosylmethionine decarboxylase | Amino acid transport and metabolism [E] | 0.79 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.79 |
COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.79 |
COG2176 | DNA polymerase III, alpha subunit (gram-positive type) | Replication, recombination and repair [L] | 0.79 |
COG3201 | Nicotinamide riboside transporter PnuC | Coenzyme transport and metabolism [H] | 0.79 |
COG3555 | Aspartyl/asparaginyl beta-hydroxylase, cupin superfamily | Posttranslational modification, protein turnover, chaperones [O] | 0.79 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 57.14 % |
Unclassified | root | N/A | 42.86 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000756|JGI12421J11937_10003997 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5896 | Open in IMG/M |
3300000756|JGI12421J11937_10021698 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2360 | Open in IMG/M |
3300002408|B570J29032_109394128 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 733 | Open in IMG/M |
3300002835|B570J40625_100005275 | Not Available | 24084 | Open in IMG/M |
3300003395|JGI25917J50250_1007084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2911 | Open in IMG/M |
3300003395|JGI25917J50250_1051942 | Not Available | 873 | Open in IMG/M |
3300003490|JGI25926J51410_1007307 | Not Available | 2303 | Open in IMG/M |
3300003490|JGI25926J51410_1020569 | All Organisms → Viruses → Predicted Viral | 1289 | Open in IMG/M |
3300003490|JGI25926J51410_1032477 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 963 | Open in IMG/M |
3300003491|JGI25924J51412_1012903 | All Organisms → Viruses → Predicted Viral | 1541 | Open in IMG/M |
3300003493|JGI25923J51411_1022269 | All Organisms → Viruses → Predicted Viral | 1273 | Open in IMG/M |
3300003497|JGI25925J51416_10035278 | Not Available | 1404 | Open in IMG/M |
3300004054|Ga0063232_10214365 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
3300004096|Ga0066177_10221037 | Not Available | 783 | Open in IMG/M |
3300004096|Ga0066177_10371351 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 617 | Open in IMG/M |
3300004096|Ga0066177_10445912 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 567 | Open in IMG/M |
3300005517|Ga0070374_10644333 | Not Available | 524 | Open in IMG/M |
3300005517|Ga0070374_10676905 | Not Available | 510 | Open in IMG/M |
3300005580|Ga0049083_10000760 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11887 | Open in IMG/M |
3300005583|Ga0049085_10007437 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4321 | Open in IMG/M |
3300005583|Ga0049085_10286379 | Not Available | 537 | Open in IMG/M |
3300005584|Ga0049082_10164945 | Not Available | 765 | Open in IMG/M |
3300005662|Ga0078894_11449406 | Not Available | 572 | Open in IMG/M |
3300005941|Ga0070743_10004225 | Not Available | 5234 | Open in IMG/M |
3300006484|Ga0070744_10004995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 3977 | Open in IMG/M |
3300006484|Ga0070744_10005051 | Not Available | 3957 | Open in IMG/M |
3300006484|Ga0070744_10044114 | All Organisms → Viruses → Predicted Viral | 1309 | Open in IMG/M |
3300006484|Ga0070744_10055724 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1156 | Open in IMG/M |
3300006484|Ga0070744_10158417 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
3300006484|Ga0070744_10159060 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 647 | Open in IMG/M |
3300006484|Ga0070744_10161365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 642 | Open in IMG/M |
3300007559|Ga0102828_1103222 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 695 | Open in IMG/M |
3300007559|Ga0102828_1120159 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 647 | Open in IMG/M |
3300007622|Ga0102863_1121017 | Not Available | 769 | Open in IMG/M |
3300007670|Ga0102862_1121237 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 661 | Open in IMG/M |
3300007974|Ga0105747_1108719 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 871 | Open in IMG/M |
3300007992|Ga0105748_10508102 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
3300009026|Ga0102829_1295756 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
3300009068|Ga0114973_10000393 | Not Available | 32776 | Open in IMG/M |
3300009068|Ga0114973_10337555 | Not Available | 798 | Open in IMG/M |
3300009152|Ga0114980_10055832 | Not Available | 2387 | Open in IMG/M |
3300009152|Ga0114980_10611921 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 615 | Open in IMG/M |
3300009154|Ga0114963_10023637 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4083 | Open in IMG/M |
3300009155|Ga0114968_10002791 | Not Available | 13214 | Open in IMG/M |
3300009155|Ga0114968_10018147 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4888 | Open in IMG/M |
3300009155|Ga0114968_10039113 | Not Available | 3120 | Open in IMG/M |
3300009155|Ga0114968_10393325 | Not Available | 758 | Open in IMG/M |
3300009158|Ga0114977_10597286 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 595 | Open in IMG/M |
3300009160|Ga0114981_10080139 | All Organisms → cellular organisms → Bacteria | 1813 | Open in IMG/M |
3300009181|Ga0114969_10001418 | Not Available | 20367 | Open in IMG/M |
3300009183|Ga0114974_10020331 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4694 | Open in IMG/M |
3300009184|Ga0114976_10002018 | Not Available | 12744 | Open in IMG/M |
3300010885|Ga0133913_12192129 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1363 | Open in IMG/M |
3300010885|Ga0133913_13280728 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1066 | Open in IMG/M |
3300013006|Ga0164294_10700625 | Not Available | 684 | Open in IMG/M |
3300013092|Ga0163199_1062971 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1637 | Open in IMG/M |
3300013372|Ga0177922_10351802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 893 | Open in IMG/M |
3300017761|Ga0181356_1039929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1652 | Open in IMG/M |
3300019146|Ga0188881_10053765 | Not Available | 501 | Open in IMG/M |
3300019784|Ga0181359_1069121 | Not Available | 1340 | Open in IMG/M |
3300019784|Ga0181359_1167141 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 739 | Open in IMG/M |
3300020141|Ga0211732_1136853 | Not Available | 15029 | Open in IMG/M |
3300020141|Ga0211732_1376574 | Not Available | 1048 | Open in IMG/M |
3300020159|Ga0211734_10863036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 3464 | Open in IMG/M |
3300020160|Ga0211733_10564397 | Not Available | 1128 | Open in IMG/M |
3300020161|Ga0211726_10072033 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3985 | Open in IMG/M |
3300020162|Ga0211735_10111644 | Not Available | 595 | Open in IMG/M |
3300020172|Ga0211729_10079684 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1082 | Open in IMG/M |
3300020172|Ga0211729_10528674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 5524 | Open in IMG/M |
3300020172|Ga0211729_10614709 | Not Available | 1004 | Open in IMG/M |
3300020172|Ga0211729_10796850 | All Organisms → Viruses → Predicted Viral | 3137 | Open in IMG/M |
3300020172|Ga0211729_11225508 | All Organisms → Viruses → Predicted Viral | 1142 | Open in IMG/M |
3300020205|Ga0211731_10564665 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
3300020506|Ga0208091_1019066 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 803 | Open in IMG/M |
3300020563|Ga0208082_1001179 | Not Available | 7578 | Open in IMG/M |
3300021519|Ga0194048_10014800 | All Organisms → cellular organisms → Bacteria | 3475 | Open in IMG/M |
3300021519|Ga0194048_10038693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1969 | Open in IMG/M |
3300021602|Ga0194060_10009714 | Not Available | 6336 | Open in IMG/M |
3300021962|Ga0222713_10104010 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2030 | Open in IMG/M |
3300022190|Ga0181354_1047610 | Not Available | 1426 | Open in IMG/M |
3300022553|Ga0212124_10476267 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 652 | Open in IMG/M |
3300023174|Ga0214921_10003731 | Not Available | 23031 | Open in IMG/M |
3300023174|Ga0214921_10274450 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 964 | Open in IMG/M |
3300023184|Ga0214919_10000488 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 67721 | Open in IMG/M |
3300024343|Ga0244777_10944185 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
3300024346|Ga0244775_10015313 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7124 | Open in IMG/M |
3300024346|Ga0244775_10018895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 6326 | Open in IMG/M |
3300024346|Ga0244775_10029768 | Not Available | 4871 | Open in IMG/M |
3300024346|Ga0244775_10050870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 3607 | Open in IMG/M |
3300024346|Ga0244775_10110504 | Not Available | 2333 | Open in IMG/M |
3300024346|Ga0244775_10155768 | Not Available | 1927 | Open in IMG/M |
3300024346|Ga0244775_10247564 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1486 | Open in IMG/M |
3300024346|Ga0244775_10248540 | All Organisms → Viruses → Predicted Viral | 1482 | Open in IMG/M |
3300024346|Ga0244775_10286952 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1366 | Open in IMG/M |
3300024346|Ga0244775_10347589 | Not Available | 1225 | Open in IMG/M |
3300024346|Ga0244775_10373785 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1174 | Open in IMG/M |
3300024346|Ga0244775_10410795 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1113 | Open in IMG/M |
3300024346|Ga0244775_10528295 | Not Available | 962 | Open in IMG/M |
3300027508|Ga0255072_1123376 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
3300027586|Ga0208966_1028249 | Not Available | 1640 | Open in IMG/M |
3300027621|Ga0208951_1000004 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 115112 | Open in IMG/M |
3300027631|Ga0208133_1035827 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1229 | Open in IMG/M |
3300027644|Ga0209356_1119398 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 756 | Open in IMG/M |
3300027656|Ga0209357_1038870 | Not Available | 1550 | Open in IMG/M |
3300027656|Ga0209357_1038948 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1548 | Open in IMG/M |
3300027689|Ga0209551_1150154 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 732 | Open in IMG/M |
3300027689|Ga0209551_1158979 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 707 | Open in IMG/M |
3300027734|Ga0209087_1000295 | Not Available | 33073 | Open in IMG/M |
3300027741|Ga0209085_1002172 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11299 | Open in IMG/M |
3300027753|Ga0208305_10130704 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 928 | Open in IMG/M |
3300027754|Ga0209596_1003081 | Not Available | 13328 | Open in IMG/M |
3300027759|Ga0209296_1221548 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 796 | Open in IMG/M |
3300027782|Ga0209500_10001644 | Not Available | 16545 | Open in IMG/M |
3300027797|Ga0209107_10000474 | Not Available | 23387 | Open in IMG/M |
3300027892|Ga0209550_10294225 | Not Available | 1048 | Open in IMG/M |
3300027892|Ga0209550_10361150 | Not Available | 911 | Open in IMG/M |
3300027892|Ga0209550_10372461 | Not Available | 893 | Open in IMG/M |
3300027892|Ga0209550_10865310 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
3300027963|Ga0209400_1001021 | Not Available | 23804 | Open in IMG/M |
3300027971|Ga0209401_1000559 | Not Available | 25223 | Open in IMG/M |
3300027973|Ga0209298_10000039 | Not Available | 73205 | Open in IMG/M |
3300032092|Ga0315905_10390282 | Not Available | 1310 | Open in IMG/M |
3300034104|Ga0335031_0018407 | Not Available | 5121 | Open in IMG/M |
3300034104|Ga0335031_0270887 | All Organisms → Viruses → Predicted Viral | 1117 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 23.02% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 19.05% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 17.46% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 11.11% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.35% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 6.35% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 4.76% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.38% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 2.38% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 2.38% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.59% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.79% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.79% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.79% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.79% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003395 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN | Environmental | Open in IMG/M |
3300003490 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN | Environmental | Open in IMG/M |
3300003491 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003493 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN | Environmental | Open in IMG/M |
3300003497 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN | Environmental | Open in IMG/M |
3300004054 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2) | Environmental | Open in IMG/M |
3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300007546 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-02 | Environmental | Open in IMG/M |
3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
3300007670 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3 | Environmental | Open in IMG/M |
3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
3300013092 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_150m | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300019146 | Metatranscriptome of marine microbial communities from Baltic Sea - GS860_ls5 | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020563 | Freshwater microbial communities from Lake Mendota, WI - 09JUN2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
3300021602 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5m | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022553 | Powell_combined assembly | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300027508 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8h | Environmental | Open in IMG/M |
3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027689 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027753 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12421J11937_1000399712 | 3300000756 | Freshwater And Sediment | MCDKYGCDYQLDLDGQVTCFNCGAMDDDMPNPRSIDNSDFERQVDFE* |
JGI12421J11937_100216984 | 3300000756 | Freshwater And Sediment | MSDAMCVKYGCDYQVDLDGQVTCSNCGAMDDDMNVNINVDNSVFETQVDFE* |
B570J29032_1093941282 | 3300002408 | Freshwater | YMTCIKAGCNYELDLDGQVTCSVCGAMDDDKQPVDIFESQIDFE* |
B570J40625_10000527552 | 3300002835 | Freshwater | MTCIKAGCNYELDLDGQVTCSVCGAMDDDKQPVDIFESQIDFE* |
JGI25917J50250_10070844 | 3300003395 | Freshwater Lake | MSDAMCTKYGCDYKLDLDGQVTCSNCGAMDDDKQPVNIFESQVDFE* |
JGI25917J50250_10519421 | 3300003395 | Freshwater Lake | MTCTKYGCDYQLDLDGQVTCAVCGAMDDDASTPITLDMFEAQVDFE* |
JGI25926J51410_10073072 | 3300003490 | Freshwater Lake | MTCTKYGCDYQLDLDGQVTCAVCGAMDDDKQPVDIFESQVDFE* |
JGI25926J51410_10205694 | 3300003490 | Freshwater Lake | MTCTKYGCDYQLDLDGQVTCAVCGAMDDDASTPINIDNSVFERQIDFE* |
JGI25926J51410_10324773 | 3300003490 | Freshwater Lake | MTCTKYGCDYQLDLDGQVTCAVCGAMDDDASTPITLDMFEAPVDFE* |
JGI25924J51412_10129032 | 3300003491 | Freshwater Lake | MTCTKYGCDYQLDLDGQVTCAVCGAMDDDASTTINIDNSVFERQIDFE* |
JGI25923J51411_10222691 | 3300003493 | Freshwater Lake | CDYQLDLDGQVTCAVCGAMDDDASTPINIDNSVFERQIDFE* |
JGI25925J51416_100352784 | 3300003497 | Freshwater Lake | MSDALCTKYGCDYQLDLDGQVTCSNCGAMDDDMNVNINVDNSVFETQVDFE* |
Ga0063232_102143652 | 3300004054 | Freshwater Lake | MSDPVCTKYGCDYQLDLDGQVTCAICGAMDDDASTPVTLDIFEKQVDFE* |
Ga0066177_102210371 | 3300004096 | Freshwater Lake | MTCTKYGCDFEIDLDGQVTCTVCGAMDDNKQPVDIFETQTDFE* |
Ga0066177_103713512 | 3300004096 | Freshwater Lake | MSDPVCTKYGCDYQLDLDGQVTCTICGAMDDDASTPATLDIFEKQVDFE* |
Ga0066177_104459122 | 3300004096 | Freshwater Lake | MGFKMSDAMCTKYGCDYQLDLDGQVTCANCGAMDDDASTPITLDMFEAQVDFE* |
Ga0070374_106443331 | 3300005517 | Freshwater Lake | EWYDVYMTCTKYGCDYQLDLDGQVTCAVCGAMDDDKQPVDIFESQIDFE* |
Ga0070374_106769051 | 3300005517 | Freshwater Lake | MSDPVCTKYGCDYQLDLDGQVTCTICGAMDDDASTPATLDIFEKQVD |
Ga0049083_1000076030 | 3300005580 | Freshwater Lentic | MSDAICSKYGCDYQLDLDGQVTCGNCGAMDDDMPNPTNVDNLAFESQVDFE* |
Ga0049085_100074374 | 3300005583 | Freshwater Lentic | MSDAMCGKYGCDYQLDLDGQVTCANCGAMDDDASTPINIDNSVFERQIDFE* |
Ga0049085_102863791 | 3300005583 | Freshwater Lentic | MSDAICSKYGCDYQLDLDGQVTCGNCGAMDDDMPNPTNVDNLAFESQMDFE* |
Ga0049082_101649453 | 3300005584 | Freshwater Lentic | MSDALCTKYGCSYELDLDGQVTCSNCGAMDDDMLPRRTYNDNDKFETQMDFE* |
Ga0078894_114494061 | 3300005662 | Freshwater Lake | MTCIKYGCDYQLDLDGQVTCAVCGAMDDDRQPVDIFETQTDFE* |
Ga0070743_100042252 | 3300005941 | Estuarine | MTCTKYGCNYELDLDGQVTCTVCGAMDDDKQPVDIFEFQVDFE* |
Ga0070744_100049953 | 3300006484 | Estuarine | MTCTKYGCDYQLDLDGQVTCAVCGAMDDDIQPVDIFETQTDFE* |
Ga0070744_100050512 | 3300006484 | Estuarine | MTHTCNYQLDLDGQVTCTVCGAMDDDMQSIFETQVDFE* |
Ga0070744_100441142 | 3300006484 | Estuarine | MTCTKYGCDYQLDLDGQVTCAVCGAMDDDASTPITLDMFEDQVDFE* |
Ga0070744_100557241 | 3300006484 | Estuarine | CTKYGCDYQLDLDGQVTCAICGAMDDDASTPITLDIFESQVDFE* |
Ga0070744_101584172 | 3300006484 | Estuarine | MSDAICTKYGCDYQLDLDGQITCANCGAMDDDMLPRRTYNDNDKFETQMDFE* |
Ga0070744_101590601 | 3300006484 | Estuarine | MMSMCVKYGCDFQLDLDGQVTCVACGAMDDDKQHAWEEKPDIKNILFESQVNFE* |
Ga0070744_101613653 | 3300006484 | Estuarine | QLDLDGQVTCAVCGAMDDDASTPITLDMFEAQVDFE* |
Ga0102874_11692181 | 3300007546 | Estuarine | MSWGILMSDAICTKYGCDYQLDLDGQVTCSNCGAMDDDMVISSNMNVNIN |
Ga0102828_11032222 | 3300007559 | Estuarine | MGFKMSDAMCTKYGCDYQLDLDGQVTCSNCGAMDDDMNVNINVDNSVFETQVDFE* |
Ga0102828_11201592 | 3300007559 | Estuarine | MCVKYGCDFQLDLDGQVTCVACGAMDDDKQHAWEEKPDIKNILFESQVNFE* |
Ga0102863_11210173 | 3300007622 | Estuarine | MSDAICTKYGCDYQLDLDGQVTCFNCGAMDDDMPNPRSIDNSDFERQVDFE* |
Ga0102862_11212372 | 3300007670 | Estuarine | MSWGILMSDAICTKYGCDYQLDLDGQVTCFNCGAMDDDMPNPRSIDNSDFERQVDFE* |
Ga0105747_11087192 | 3300007974 | Estuary Water | CTKYGCDYQLDLDGQVTCFNCGAMDDDMPNPRSIDNSDFERQVDFE* |
Ga0105748_105081021 | 3300007992 | Estuary Water | MTCTKYGCDYELDLDGQVTCTVCGAMDDDMKPDIFESQIDFE* |
Ga0102829_12957562 | 3300009026 | Estuarine | AMCTKYGCDYQLDLDGQVTCSNCGAMDDDMNVNINVDNSVFETQVDFE* |
Ga0114973_1000039358 | 3300009068 | Freshwater Lake | MKWYDVYMTCTKYGCDYQLDLDGQVTCAVCGAMDDDASTPITLDMFEAQVDFE* |
Ga0114973_103375552 | 3300009068 | Freshwater Lake | MTHDCNYELDLDGQVTCTLCGAMDDDMCPSGDMQSIFETQIDFE* |
Ga0114980_100558325 | 3300009152 | Freshwater Lake | MICTKYGCNYELDLDGQVTCTVCGAMDDDKQPVDIFETQTDFE* |
Ga0114980_106119212 | 3300009152 | Freshwater Lake | MTCTKYGCDYQLDLDGQVTCSVCGAMDDDKQPVDIFEAQVDFE* |
Ga0114963_1002363714 | 3300009154 | Freshwater Lake | MTHNCTFDLDLDGQVTCTVCGAMDDDKEPNKIFEEQVDFE* |
Ga0114968_100027919 | 3300009155 | Freshwater Lake | MTHVCNYELDLDGQVTCTVCGAMDDDMSHSDDVDIFESQIDFE* |
Ga0114968_100181475 | 3300009155 | Freshwater Lake | MSDALCTKYGCDYQLDLDGQITCFNCGAMDDDMLPRRTYNDNDKFETQVDFE* |
Ga0114968_100391136 | 3300009155 | Freshwater Lake | MTHDCNYELDLDGQVTCTVCGAMDDDMCPSGDMQSIFETQIDFE* |
Ga0114968_103933252 | 3300009155 | Freshwater Lake | MTCTKYGCNYELDLDGKVTCTVCGAMDDDMSPTTLDMFEAQVDFE* |
Ga0114977_105972862 | 3300009158 | Freshwater Lake | MSNDQLCNKYGCNYELDLDGQVTCSNCGAMGDDMPNPTGIKNSAFETQVDFE* |
Ga0114981_100801392 | 3300009160 | Freshwater Lake | MTCTKYGCNYELDLDGQVTCTVCGAMDDDMSPITLDMFEAQVDFE* |
Ga0114969_1000141811 | 3300009181 | Freshwater Lake | MSDAMCTKYGCDYKLDLDGQVTCSNCGAMGDDMPNPQSADNSVFERQIDFE* |
Ga0114974_100203311 | 3300009183 | Freshwater Lake | MTCTKYGCDYQLDLDGQVTCAVCGAMDDDKQPVDIFEAQVDFE* |
Ga0114976_1000201833 | 3300009184 | Freshwater Lake | MTCTKYGCDYQLDLDGQVTCAVCGAMDDDASTPITLDMFESQVDFE* |
Ga0133913_121921291 | 3300010885 | Freshwater Lake | MHDCNYELDLDGQVTCTVCGAMDDDASTPITLDMFEDQVDFE* |
Ga0133913_132807282 | 3300010885 | Freshwater Lake | MSDAMCTKYGCDYQLDLDGQVTCSNCGAMDDDMPNPRSIENSDFERQVDFE* |
Ga0164294_107006253 | 3300013006 | Freshwater | MFDLDLDGQVTCTVCGAMDDDKQPVDIFESQIDFE* |
Ga0163199_10629712 | 3300013092 | Freshwater | MSDAMCTKYGCDYQLDLDGQITCFNCGAMDDDMLPRRIYNENDKFESQVDFE* |
Ga0177922_103518021 | 3300013372 | Freshwater | YELDLDGQVTCTVCGAMDDDKQPVDIFEFQVDFE* |
Ga0181356_10399293 | 3300017761 | Freshwater Lake | MTCTKYGCNYELDLDGQVTCTVCGAMDDDASTPINIDNSVFERQIDFE |
Ga0188881_100537652 | 3300019146 | Freshwater Lake | MSDALCIKYGCDYQLDLDGQVTCDNCGAMGDDMPNPQPVDNSVFERQVDFE |
Ga0181359_10691213 | 3300019784 | Freshwater Lake | MTCTKYGCDYQLDLDGQVTCAVCGAMDDDASTPITLDMFEAQVDFE |
Ga0181359_11671411 | 3300019784 | Freshwater Lake | MSDAMCTKYGCDYKLDLDGQVTCSNCGAMDDDKQPVNIFESQVDFE |
Ga0211732_113685311 | 3300020141 | Freshwater | MTCTKYGCDYQLDLDGQVTCAVCGAMDDDKQPVDIFETQTDFE |
Ga0211732_13765743 | 3300020141 | Freshwater | MSDAICSKYGCDYELDLDGQVTCSNCGAMDDDMPNPTNVDNLAFESQMDFE |
Ga0211734_108630362 | 3300020159 | Freshwater | MSDALCTKYGCDYKLDLDGQVTCDNCGAMGDDMPNPQSVDNSVFERQVDFE |
Ga0211733_101156463 | 3300020160 | Freshwater | MTCTKYGCNYELDLDGQVTCSVCGAMDDDMKPDIFESQIDFE |
Ga0211733_105643973 | 3300020160 | Freshwater | EKIISLKTYWIIKMTCTKYGCDYELDLDGQVTCTVCGAMDDDRQPINIFETQVDFE |
Ga0211726_100720336 | 3300020161 | Freshwater | MTCTKYGCNYELDLDGQVTCTVCGAMDDDIQPVNIFETQVDFE |
Ga0211735_101116441 | 3300020162 | Freshwater | MSDAICSKYGCDYELDLDGQVTCSNCGAMDDDMPNPTNVDNLAFESQMD |
Ga0211729_100796843 | 3300020172 | Freshwater | MTCSKYGCDYELDLDGQVTCTVCGAMDDDRQPINIFETQVDFE |
Ga0211729_105286749 | 3300020172 | Freshwater | MTCTKYGCDYELDLDGQVTCTVCGAMDDDKQPVDIFETQTDFE |
Ga0211729_106147091 | 3300020172 | Freshwater | MTHECNYELDLDGQVTCTVCGSMDDDMCRSDNKQSIFE |
Ga0211729_107968506 | 3300020172 | Freshwater | MTCTKYGCNYELDLDGQVTCTVCGAMDDDIQPVNIFETQIDFE |
Ga0211729_112255082 | 3300020172 | Freshwater | VSNEQLCNKYGCNYELDLDGQVTCSNCGGMGDDMPNPININNSAFETQVDFE |
Ga0211731_105646651 | 3300020205 | Freshwater | AICSKYGCDYELDLDGQVTCSNCGAMDDDMPNPTNVDNLAFESQMDFE |
Ga0208091_10190661 | 3300020506 | Freshwater | MTCIKAGCNYELDLDGQVTCSVCGAMDDDKQPVDIFESQIDFE |
Ga0208082_100117918 | 3300020563 | Freshwater | FFAEWYDVYMTCIKAGCNYELDLDGQVTCSVCGAMDDDKQPVDIFESQIDFE |
Ga0194048_100148003 | 3300021519 | Anoxic Zone Freshwater | MSWGILMSDAICTKYGCDYQLDLDGQVTCSNCGAMDDDMPNPQPADNSVFERQIDFE |
Ga0194048_100386934 | 3300021519 | Anoxic Zone Freshwater | MICSKYGCDYQLDLDGQVTCVNCGAMDDDKQPIDLKHFESQVDFE |
Ga0194060_100097147 | 3300021602 | Anoxic Zone Freshwater | MSDAICTKYGCDYQLDLDGQVTCSNCGAMDDDMPNPQPADNSVFERQIDFE |
Ga0222713_101040103 | 3300021962 | Estuarine Water | MTCTKYGCNYELDLDGQVTCTVCGSMDDDKEPVNIFETQMDFE |
Ga0181354_10476102 | 3300022190 | Freshwater Lake | MTCTKYGCDYQLDLDGQVTCAVCGAMDDDASTPINIDNSVFERQIDFE |
Ga0212124_104762671 | 3300022553 | Freshwater | MCTKYGCDYQLDLDGQITCFNCGAMDDDMLPRRIYNENDKFESQVDFE |
Ga0214921_100037312 | 3300023174 | Freshwater | MTCTKYGCNYELDLDGQVTCTVCGAMDDDMSPITLNMFESQVDFE |
Ga0214921_102744503 | 3300023174 | Freshwater | MSDAMCDKYGCDYQLDLDGQVTCFNCGAMGDDMPNPRRIDNSDFERQVDFE |
Ga0214919_100004885 | 3300023184 | Freshwater | MSDAMCTKYGCDYKLDLDGQVTCSNCGAMGDDMPNPQSADNSVFERQIDFE |
Ga0244777_109441853 | 3300024343 | Estuarine | MGFKMSDAMCTKYGCDYQLDLDGQVTCSNCGAMDDDMNVNINVDNSVFETQVDFE |
Ga0244775_100153133 | 3300024346 | Estuarine | MSDAMCGKYGCDYQLDLDGQVTCANCGAMDDDASTPINIDNSVFERQIDFE |
Ga0244775_100188956 | 3300024346 | Estuarine | MTCTKYGCDYQLDLDGQVTCAVCGAMDDDIQPVDIFETQTDFE |
Ga0244775_100297682 | 3300024346 | Estuarine | MTHTCNYQLDLDGQVTCTVCGAMDDDMQSIFETQVDFE |
Ga0244775_100508704 | 3300024346 | Estuarine | MTCTKYGCDYQLDLDGQVTCAVCGAMDDDKQPVDIFESQVDFE |
Ga0244775_101105044 | 3300024346 | Estuarine | MTDALCSKYGCDYQLDLDGQVTCFNCGAMDDDASTPITLNMFESQVDFE |
Ga0244775_101557684 | 3300024346 | Estuarine | MSDAICTKYGCDYQLDLDGQITCANCGAMDDDMLPRRTYNDNDKFETQMDFE |
Ga0244775_102475642 | 3300024346 | Estuarine | MMSMCVKYGCDFQLDLDGQVTCVACGAMDDDKQHAWEEKPDIKNILFESQVNFE |
Ga0244775_102485402 | 3300024346 | Estuarine | MTCTKYGCDYQLDLDGQVTCAVCGAMDDDASTPITLDMFEDQVDFE |
Ga0244775_102869522 | 3300024346 | Estuarine | MSDALCTKYGCSYELDLDGQVTCSNCGAMDDDMLPRRTYNDNDKFETQMDFE |
Ga0244775_103475892 | 3300024346 | Estuarine | MTCTKYGCDFEIDLDGQVTCTVCGAMDDNKQPVDIFETQTDFE |
Ga0244775_103737853 | 3300024346 | Estuarine | YGCDYQLDLDGQVTCSNCGAMDDDMLPRRTYNENDKFESQVDFE |
Ga0244775_104107952 | 3300024346 | Estuarine | MSDAICTKYGCDYQLDLDGQVTCAICGAMDDDASTPITLDIFESQVDFE |
Ga0244775_105282952 | 3300024346 | Estuarine | MSDAICTKYGCDYQLDLDGQVTCFNCGAMDDDMPNPRSIDNSDFERQVDFE |
Ga0255072_11233762 | 3300027508 | Freshwater | MSDAMCTKYGCDYQLDLDGQVTCSNCGAMDDDMNVNINVDNSVFETQVDFE |
Ga0208966_10282494 | 3300027586 | Freshwater Lentic | MSDAICSKYGCDYQLDLDGQVTCGNCGAMDDDMPNPTNVDNLAFESQMDFE |
Ga0208951_1000004135 | 3300027621 | Freshwater Lentic | MSDAICSKYGCDYQLDLDGQVTCGNCGAMDDDMPNPTNVDNLAFESQVDFE |
Ga0208133_10358271 | 3300027631 | Estuarine | YGCDYKLDLDGQVTCSNCGAMGDDMPNPQSADNSVFERQIDFE |
Ga0209356_11193982 | 3300027644 | Freshwater Lake | GCDYQLDLDGQVTCSNCGAMDDDKQPVNIFEAQVDFE |
Ga0209357_10388704 | 3300027656 | Freshwater Lake | MSDALCTKYGCDYQLDLDGQVTCSNCGAMDDDMNVNINVDNSVFETQVDFE |
Ga0209357_10389481 | 3300027656 | Freshwater Lake | WYDVYMTCTKYGCDYQLDLDGQVTCAVCGAMDDDASTPITLDMFEAQVDFE |
Ga0209551_11501541 | 3300027689 | Freshwater Lake | KSFNRTSNGGISRMSDPVCTKYGCDYQLDLDGQVTCAICGAMDDDASTPVTLDIFEKQVDFE |
Ga0209551_11589792 | 3300027689 | Freshwater Lake | YDVYMTCTKYGCDYQLDLDGQVTCAVCGAMDDDASTPITLDMFEAQVDFE |
Ga0209087_10002952 | 3300027734 | Freshwater Lake | MTCTKYGCDYQLDLDGQVTCAVCGAMDDDASTPITLDMFESQVDFE |
Ga0209085_10021724 | 3300027741 | Freshwater Lake | MTHNCTFDLDLDGQVTCTVCGAMDDDKEPNKIFEEQVDFE |
Ga0208305_101307043 | 3300027753 | Estuarine | MTCTKYGCNYELDLDGQVTCTVCGAMDDDKQPVDIFESQVDFE |
Ga0209596_100308127 | 3300027754 | Freshwater Lake | MSDALCTKYGCDYQLDLDGQITCFNCGAMDDDMLPRRTYNDNDKFETQVDFE |
Ga0209296_12215482 | 3300027759 | Freshwater Lake | MSNDQLCNKYGCNYELDLDGQVTCSNCGAMGDDMPNPTGIKNSAFETQVDFE |
Ga0209500_100016446 | 3300027782 | Freshwater Lake | MTCTKYGCDYQLDLDGQVTCAVCGAMDDDKQPVDIFETQVDFE |
Ga0209107_1000047411 | 3300027797 | Freshwater And Sediment | MCDKYGCDYQLDLDGQVTCFNCGAMDDDMPNPRSIDNSDFERQVDFE |
Ga0209550_102942252 | 3300027892 | Freshwater Lake | MSDPVCTKYGCDYQLDLDGQVTCAICGAMDDDASTPVTLDIFEKQVDFE |
Ga0209550_103611502 | 3300027892 | Freshwater Lake | MSDPICTKYGCDYQLDLDGQVTCAICGAMDDDASTPITLDIFEKQVDFE |
Ga0209550_103724611 | 3300027892 | Freshwater Lake | MTCTKYGCDYQLDLDGKVTCTVCGAMDDDRQPVDIFETQTDFE |
Ga0209550_108653101 | 3300027892 | Freshwater Lake | MCTKYGCDYQLDLDGQVTCSNCGAMDDDKQPVNIFEAQVDFE |
Ga0209400_100102164 | 3300027963 | Freshwater Lake | MTHVCNYELDLDGQVTCTVCGAMDDDMSHSDDVDIFESQIDFE |
Ga0209401_100055951 | 3300027971 | Freshwater Lake | MKWYDVYMTCTKYGCDYQLDLDGQVTCAVCGAMDDDASTPITLDMFEAQVDFE |
Ga0209298_100000392 | 3300027973 | Freshwater Lake | MICTKYGCNYELDLDGQVTCTVCGAMDDDKQPVDIFETQTDFE |
Ga0315905_103902821 | 3300032092 | Freshwater | MTCTKYGCDYQLDLDGQVTCAVCGAMDDDASTPINIDNSVFERQI |
Ga0335031_0018407_4810_4935 | 3300034104 | Freshwater | MTCIKAGCNYELDLDGQVTCSVCGAMDDDKQSIFETQVDFE |
Ga0335031_0270887_896_1021 | 3300034104 | Freshwater | MTCIKAGCNYELDLDGQVTCAVCGAMDDDKQSIFESQIDFE |
⦗Top⦘ |