NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0222717_10502919

Scaffold Ga0222717_10502919


Overview

Basic Information
Taxon OID3300021957 Open in IMG/M
Scaffold IDGa0222717_10502919 Open in IMG/M
Source Dataset NameEstuarine water microbial communities from San Francisco Bay, California, United States - C33_18D
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)652
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water → Estuarine Microbial Communities From The San Francisco Bay-Delta (Sfbd), California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)37.0966Long. (o)-122.4216Alt. (m)Depth (m)38
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F039146Metagenome / Metatranscriptome164N

Sequences

Protein IDFamilyRBSSequence
Ga0222717_105029193F039146AGGAMKNKKNCGCLSKYMKPSIQGTKGSKGRGSWDAKPVRRITNPGRR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.