 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F039146 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 164 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MKNKKNCGCLSKYMKPSIQGTKGSKGRNGWDAKPVFRITNPGRR |
| Number of Associated Samples | 115 |
| Number of Associated Scaffolds | 164 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 66.26 % |
| % of genes near scaffold ends (potentially truncated) | 40.85 % |
| % of genes from short scaffolds (< 2000 bps) | 71.34 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (54.878 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (12.805 % of family members) |
| Environment Ontology (ENVO) | Unclassified (58.537 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (56.098 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 6.82% Coil/Unstructured: 93.18% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 164 Family Scaffolds |
|---|---|---|
| PF08291 | Peptidase_M15_3 | 25.00 |
| PF00166 | Cpn10 | 5.49 |
| PF11351 | GTA_holin_3TM | 1.83 |
| PF00118 | Cpn60_TCP1 | 1.22 |
| PF03382 | DUF285 | 1.22 |
| PF02867 | Ribonuc_red_lgC | 0.61 |
| COG ID | Name | Functional Category | % Frequency in 164 Family Scaffolds |
|---|---|---|---|
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 5.49 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 1.22 |
| COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 0.61 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 54.88 % |
| All Organisms | root | All Organisms | 45.12 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 12.80% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 9.15% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 7.93% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 7.32% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 6.71% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine | 6.10% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 4.27% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 4.88% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 3.66% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 3.66% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 3.66% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 3.05% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 2.44% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.44% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 2.44% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 1.83% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.83% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.83% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 1.83% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 1.83% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.22% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.22% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.22% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 1.22% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.61% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.61% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.61% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.61% |
| Sediment | Environmental → Aquatic → Marine → Unclassified → Unclassified → Sediment | 0.61% |
| Diffuse Hydrothermal Flow Volcanic Vent | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent | 0.61% |
| Marine | Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine | 0.61% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.61% |
| Marine Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment | 0.61% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000118 | Marine microbial communities from chronically polluted sediments in Tierra del Fuego - site OR sample ARG 06_12.3m | Environmental | Open in IMG/M |
| 3300000120 | Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 2 sample NOR 13_50m | Environmental | Open in IMG/M |
| 3300000121 | Marine microbial communities from chronically polluted sediments in Tierra del Fuego - site MC sample ARG 03_11.3m | Environmental | Open in IMG/M |
| 3300000127 | Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 1 sample NOR 05_45m | Environmental | Open in IMG/M |
| 3300000130 | Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 2 sample NOR 15_50m | Environmental | Open in IMG/M |
| 3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
| 3300000949 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94 | Host-Associated | Open in IMG/M |
| 3300001344 | Pelagic Microbial community sample from North Sea - COGITO 998_met_02 | Environmental | Open in IMG/M |
| 3300001348 | Pelagic Microbial community sample from North Sea - COGITO 998_met_04 | Environmental | Open in IMG/M |
| 3300001351 | Pelagic Microbial community sample from North Sea - COGITO 998_met_03 | Environmental | Open in IMG/M |
| 3300003264 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_54_BLW_10 | Environmental | Open in IMG/M |
| 3300003543 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS898_N3Area_DNA | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300005264 | Hydrothermal sediment microbial communities from Guaymas Basin, California, USA 4572. Combined assembly of Gp0115316 and Gp0146562 | Environmental | Open in IMG/M |
| 3300005588 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1 | Environmental | Open in IMG/M |
| 3300005590 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 | Environmental | Open in IMG/M |
| 3300005600 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1 | Environmental | Open in IMG/M |
| 3300005920 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2 | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006467 | Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935 | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007647 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02 | Environmental | Open in IMG/M |
| 3300007954 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_0.2um | Environmental | Open in IMG/M |
| 3300008470 | Sediment core microbial communities from Adelie Basin, Antarctica. Combined Assembly of Gp0136540, Gp0136562, Gp0136563 | Environmental | Open in IMG/M |
| 3300009003 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725 | Environmental | Open in IMG/M |
| 3300009024 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 | Environmental | Open in IMG/M |
| 3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
| 3300009074 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 | Environmental | Open in IMG/M |
| 3300009135 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 382 cmbsf | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009422 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009441 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome | Environmental | Open in IMG/M |
| 3300009472 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009526 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 | Environmental | Open in IMG/M |
| 3300009544 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome | Environmental | Open in IMG/M |
| 3300009599 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300012524 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300013098 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay11, Core 4567-28, 0-3 cm | Environmental | Open in IMG/M |
| 3300013101 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay4, Core 4569-4, 0-3 cm | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017742 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300018980 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127) | Environmental | Open in IMG/M |
| 3300019214 | Estuarine microbial communities from the Columbia River estuary - R.1189 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020166 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1 | Environmental | Open in IMG/M |
| 3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
| 3300020347 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994) | Environmental | Open in IMG/M |
| 3300020382 | Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059) | Environmental | Open in IMG/M |
| 3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
| 3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022061 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2) | Environmental | Open in IMG/M |
| 3300022164 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2) | Environmental | Open in IMG/M |
| 3300022201 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022220 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022836 | Saline water microbial communities from Ace Lake, Antarctica - #421 | Environmental | Open in IMG/M |
| 3300022913 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_2_MG | Environmental | Open in IMG/M |
| 3300023089 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_11_MG | Environmental | Open in IMG/M |
| 3300023112 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MG | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300023276 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_1_MG | Environmental | Open in IMG/M |
| 3300024062 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1 | Environmental | Open in IMG/M |
| 3300024255 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MG | Environmental | Open in IMG/M |
| 3300024519 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27 | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025266 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 (SPAdes) | Environmental | Open in IMG/M |
| 3300025276 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027197 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743 (SPAdes) | Environmental | Open in IMG/M |
| 3300027672 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027687 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300027752 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300027790 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027820 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027833 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027858 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027861 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG | Environmental | Open in IMG/M |
| 3300027881 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_27 | Environmental | Open in IMG/M |
| 3300027967 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027978 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027996 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MG | Environmental | Open in IMG/M |
| 3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
| 3300028196 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10m | Environmental | Open in IMG/M |
| 3300031167 | Marine microbial communities from water near the shore, Antarctic Ocean - #418 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031601 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #133 | Environmental | Open in IMG/M |
| 3300031628 | Marine microbial communities from water near the shore, Antarctic Ocean - #229 | Environmental | Open in IMG/M |
| 3300031638 | Marine microbial communities from Western Arctic Ocean, Canada - CB4_surface | Environmental | Open in IMG/M |
| 3300031705 | Marine microbial communities from water near the shore, Antarctic Ocean - #36 | Environmental | Open in IMG/M |
| 3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100160116 | 3300000101 | Marine | MKKSKLNCGCLSKYMKPAQTGTKGSKGRNGWDAKPVFRITNPRGR* |
| DelMOSum2011_100097018 | 3300000115 | Marine | MKNKKNCGCLSKYMKPSVKGTKGSKGRNGWDAKPVFRITNPGRR* |
| DelMOSum2011_100166638 | 3300000115 | Marine | MKNKKNCGCLSKYMKPSVKGTKGSKGRNGWDAKPAFRITNPGRR* |
| DelMOSum2011_101763993 | 3300000115 | Marine | MKKSKLNCGCLSKYMKPAQTGTKGSKGRNGWDAKPVFRITNPGRR* |
| DelMOSum2011_101787603 | 3300000115 | Marine | MKKSKLNCGCLSKYMKPAQTGTKGSKGRNGWDAKPV |
| TDF_OR_ARG05_123mDRAFT_10020135 | 3300000118 | Marine | MKNKKNCGCLSKYMKPSIQGTKGSRGRNGWDAKPVFRITNPGKI* |
| SA_S2_NOR13_50mDRAFT_10031508 | 3300000120 | Marine | MNKKKNNCGCLSKYMKSEFKGTKGSKGRNGWDAKPVFRITNPRSR* |
| SA_S2_NOR13_50mDRAFT_10036499 | 3300000120 | Marine | MKNKKNCGCLSKYMKPSIQGTKGSKGRGGWDAKPVFRITNPGRR* |
| TDF_OR_ARG04_113mDRAFT_10114814 | 3300000121 | Marine | MKGKKNCGCLSKYMKPSIQGTKGSKGRNKWDAKPVYRITNPGRR* |
| TDF_OR_ARG04_113mDRAFT_10153382 | 3300000121 | Marine | MKNKKNCGCLSKYMKPSIQGTKGSKGRNGWDAKPVYRITNPGRR* |
| TDF_OR_ARG04_113mDRAFT_10293113 | 3300000121 | Marine | MKNKKNCGCLSKYMKPSTQGTKGLKGRNGWDAKPVFRITNPGKI* |
| TDF_OR_ARG04_113mDRAFT_10312741 | 3300000121 | Marine | MKNKKNCGCLSKYMKPSIQGTKGSRGRNGWDAKPVFRITN |
| TDF_OR_ARG04_113mDRAFT_10314681 | 3300000121 | Marine | CGCLSKYMKPSIQGTKGSRGRNGWDAKPVFRITNPGKI* |
| SA_S1_NOR05_45mDRAFT_101125072 | 3300000127 | Marine | MKDKKSNCGCLSKYMKTAQTGTKGSKGRNGWDAKPVFRITNPGRR* |
| SA_S2_NOR15_50mDRAFT_100871791 | 3300000130 | Marine | MKNKKNCGCLSKYMKPSIQGTKGSKGRGGWDAKPVFRITNPGRR |
| BBAY92_100781163 | 3300000947 | Macroalgal Surface | MKRNKPNCGCLSKYMKKPQIGTKGSKGRGGWDAKPVFRITNPGR |
| BBAY94_101496973 | 3300000949 | Macroalgal Surface | QEENGTVNMKRSKPNCGCLSKYMKTAQTGVKGSKGRNGWDAKPVFRITNPRNR* |
| JGI20152J14361_100516063 | 3300001344 | Pelagic Marine | LREENGTVNMKKSKLNCGCLSKYMKPAQXGTKGSKGRNGWDAKPVFRITNPRNR* |
| JGI20154J14316_100467854 | 3300001348 | Pelagic Marine | MKKSKLNCGCLSKYMKPAQAGTKGSKGRNGWDAKPVFRITNPRSR* |
| JGI20153J14318_101164144 | 3300001351 | Pelagic Marine | EENGTVSMKKKKANCGCFSKYMKPSVQGTKGSKGRNGWDAKPVFRITNPGRR* |
| JGI26119J46589_10074084 | 3300003264 | Marine | MKNKKNCGCLSKYMKPSIQGTKGSKGRGSWDAKPVRRITNPGRR* |
| FS898DNA_105681044 | 3300003543 | Diffuse Hydrothermal Flow Volcanic Vent | MKRNKPNCGCLSKYMKSEFKGTKGSKGRNGWDAKPVFRITNPGRR* |
| Ga0055584_1013163792 | 3300004097 | Pelagic Marine | MKNKKNCGCLSKYMKPSIQGTKGSKGRNKWDAKPVYRITNPGRR* |
| Ga0073581_11036810 | 3300005264 | Sediment | MKNKKNCGCFSKYMKPSVKGTKGSKGRNGWDAKPVFRITNPGRR* |
| Ga0070728_100437031 | 3300005588 | Marine Sediment | KKNCGCLSKYMKPSIQGTKGSKGRGGWDAKPVRRITNPGRR* |
| Ga0070728_101513533 | 3300005588 | Marine Sediment | MKNKKNCGCLSKYMKPSIQGTKGSKGRNGWDAKPVFRITNPGKI* |
| Ga0070727_100605709 | 3300005590 | Marine Sediment | GCLSKYMKPSIQGTKGSKGRNGWDAKPVFRITNPGKI* |
| Ga0070727_102893093 | 3300005590 | Marine Sediment | MKNKKNCGCLSKYMKPSIQGTKGSKGRGGWDAKPVRRITNPGRR* |
| Ga0070726_100663757 | 3300005600 | Marine Sediment | MKDKKSNCGCLSKYMKTAQTGTKGSKGRNGWDAKPVFRITN |
| Ga0070726_107149851 | 3300005600 | Marine Sediment | MKKSKLNCGCLSKYMKPAQAGTKGSKGRNGWDAKPVFRITNPRSR |
| Ga0070725_100366079 | 3300005920 | Marine Sediment | NMKNKKNCGCLSKYMKPSIQGTKGSKGRNGWDAKPVFRITNPGKI* |
| Ga0070725_103762732 | 3300005920 | Marine Sediment | MKRNKPNCGCLSKYMKPAQTGTKGSKGRNGWDAKPVFRITNPRSR* |
| Ga0075466_10670144 | 3300006029 | Aqueous | LSKYMKPSVKGTKGSKGRNGWDAKPAFRITNPGRR* |
| Ga0099972_102863443 | 3300006467 | Marine | MNKKKNNCGCLSKYMKSEFKGTKSSKGRNGWDAKPVFRITNPGRR* |
| Ga0099972_103643102 | 3300006467 | Marine | MKKNKPNCGCLSKYMKTPQIGVKGSNGRNGWDAKPVFRITNPRSR* |
| Ga0098038_10015058 | 3300006735 | Marine | MKRNKPNCGCLSKYMKSEFKGTKGSKGRNGWDAKPVFRITKPGRR* |
| Ga0098048_10069523 | 3300006752 | Marine | MKNKKNCGCLSKYMKPSIKGAKGSKGRNGWDSKPVFRITNPGRR* |
| Ga0070749_101758391 | 3300006802 | Aqueous | VELHEENGTANMKNKKNCGCLSKYMKPSIQGTKGSKGRGGWDAKPVRRITNPGRR* |
| Ga0075467_100749054 | 3300006803 | Aqueous | MKRNKPNRGCLSKYMKSEFKVTKGSKGRSGWDAKPVFRITKPGRR* |
| Ga0075444_100111479 | 3300006947 | Marine | MKKSKPNCGCLSKYMKTAQTGTKGSKGRNGWDAKPVFRITNPGRR* |
| Ga0098046_10046811 | 3300006990 | Marine | NKKNCGCLSKYMKPSIKGAKGSKGRNGWDSKPVFRITNPGRR* |
| Ga0070747_13463072 | 3300007276 | Aqueous | MKKSKLNCGCLSKYMKPAQTGVKGSKGRNGWDAKPVFRITN |
| Ga0070752_10558376 | 3300007345 | Aqueous | TANMKNKKNCGCLSKYMKPSIQGTKGSKGRGGWDAKPVRRITNPGRR* |
| Ga0099847_11681294 | 3300007540 | Aqueous | GCLSKYMKPSIKGAKGSKGRNGWDSKPVFRITNPGRR* |
| Ga0102855_11765682 | 3300007647 | Estuarine | MKNKKNCGCFSKYMKPSIKGTKGSKGRNGWDAKPVFRITNPGR |
| Ga0105739_11444481 | 3300007954 | Estuary Water | CLSKYMKTPQIGVKGSKGRNGWDAKPVFRITNPGRR* |
| Ga0115371_100943611 | 3300008470 | Sediment | MKDKKSNCGCLSKYMKTAQTGTKGSKGRNGWDAKPVF |
| Ga0115371_103172711 | 3300008470 | Sediment | MKRTKPNCGCLSKYMKIPQTGVKGSKGRNGWDAKPVFRITNPGRR* |
| Ga0115371_103808244 | 3300008470 | Sediment | KKSNCGCLSKYMKTAQTGTKGSKGRNGWDAKPVFRITNPGRR* |
| Ga0115371_109290081 | 3300008470 | Sediment | KNKKNCGCLSKYMKPSIQGTKGSKGRNGWDAKPVYRITNPGRR* |
| Ga0115371_109491634 | 3300008470 | Sediment | MKRSKPNCGCLSKYMKTAQTGTKGSKGRNGWDAKPVFRITNPGRR* |
| Ga0115371_112705474 | 3300008470 | Sediment | MKRNKPNCGCLSKYMKTPQTGVKGSKGRNGWDAKPVFRITNPGRR* |
| Ga0102813_12728522 | 3300009003 | Estuarine | MKNKKNCGCLSKYMKPSTQGTKGSKGRNGWDAKPVFRITNPGKI* |
| Ga0102811_14017953 | 3300009024 | Estuarine | MKNKKNCGCLSKYMKPSIQGTKGSKERNGWDAKPVFRITNPGKI* |
| Ga0102830_11773391 | 3300009059 | Estuarine | NMKNKKNCGCLSKYMKPSIQGTKGSKGRRGWDAKPVRRITNPGRR* |
| Ga0115549_10727893 | 3300009074 | Pelagic Marine | MKKKKANCGCFSKYMKPSVQGTKGSKGRNGWDAKPVFRITNPGRR* |
| Ga0118736_101365474 | 3300009135 | Marine Sediment | VNMKNKKNCGCLSKYMKPSVKGTKGSKGRNGWDAKPAFRITNPGRR* |
| Ga0114995_101306004 | 3300009172 | Marine | MKRNKPNCGCLSKYMKTPQTGTKGSKGRNGWDAKPVFRITNPGRR* |
| Ga0114995_102152843 | 3300009172 | Marine | MKKNKPNCGCLSKYMKTAQTGTKGSKGRNGWDAKPVFRITNPGKR* |
| Ga0114995_106188982 | 3300009172 | Marine | QAFASQIKKASKMKDKKSNCGCLSKYMKIAQTGIKGSKGRNGWDAKPVFRITRPGK* |
| Ga0114998_100373115 | 3300009422 | Marine | MKDKKSNCGCLSKYMKIAQTGIKGSKGRNGWDAKPVFRITRPGK* |
| Ga0114998_100865965 | 3300009422 | Marine | MKRNKPNCGCLSKYMKTPQIGTKGSKGRNGWDAKPVFRITNPGRR* |
| Ga0114915_11273604 | 3300009428 | Deep Ocean | MKRTKPNCGCLSKYMKTAQTGTKGSKGRDGWDAKPVFRITNPGRR* |
| Ga0115007_107815722 | 3300009441 | Marine | MKNKKNCGCFSKYMKPSIKGTKGSKGRNGWDAKPVFRITNPGRR* |
| Ga0115554_13158661 | 3300009472 | Pelagic Marine | MKNKKNCGCLSKYMKPSIKGTKGSKGRNGWDAKPVFRITN |
| Ga0115003_100317769 | 3300009512 | Marine | MKNKKNCGCLSKYMKPSIQGTKGSKGRNGWDAKPVFRITNPGRR* |
| Ga0115004_108673971 | 3300009526 | Marine | EENGIANMKRNKPNCGCLSKYMKTPQIGTKGSKGRNGWDAKPVFRITNPRSR* |
| Ga0115004_108719921 | 3300009526 | Marine | EENGIANMKRNKPNCGCLSKYMKTPQIGTKGSKGRNGWDAKPVFRITNPGRR* |
| Ga0115006_119275961 | 3300009544 | Marine | TVNMKNKKNCGCFSKYMKPSTQGTKGSKGRNGWDAKPVFRITNPGRR* |
| Ga0115103_13202685 | 3300009599 | Marine | MKKKKANCGCFSKYMKPSVQGTKGSKGRNGWDAKPVFRVTNPGRR* |
| Ga0115103_16125823 | 3300009599 | Marine | MKKKKTNCGCFSKYMKTPQIGVKASKGRNGWDAKPVFRITNPGRR* |
| Ga0115001_109241102 | 3300009785 | Marine | MKNKKNCGCFSKYMKPSIQGTKGSKGRNGWDAKPVFRITNPGKI* |
| Ga0129324_101911031 | 3300010368 | Freshwater To Marine Saline Gradient | EENGIVNMKNKKNCGCLSKYMKPSVKGTKGSKGRNGWDAKPAFRITNPGRR* |
| Ga0118731_1062877361 | 3300010392 | Marine | KNCGCLSKYMKPSIQGTKGSKGRGGWDAKPVRRITNPGRR* |
| Ga0118731_1074194831 | 3300010392 | Marine | NMKRNKPNCGCLSKYMKTPQIGVKGSKGRSGWDAKPVFRITNPGRR* |
| Ga0118731_1086151426 | 3300010392 | Marine | MNKKKNNCGCLSKYMKSEFKGTKGSKGRNGWDAKPVFRITNPGRR* |
| Ga0118731_1123376186 | 3300010392 | Marine | MKNKKNCGCLSKYMKPSMKGTKGSKGRNGWDAKPVFRITNPGRR* |
| Ga0129331_14648433 | 3300012524 | Aqueous | MNKKKNNCGCLSKYMKSEFKGTKSSKERNGWDAKPVFRITNPGRR* |
| Ga0129327_108577382 | 3300013010 | Freshwater To Marine Saline Gradient | MKNKKNCGCLSKYMKPSIKGTKGSKGRNGWDAKPVFRITNPGRR* |
| Ga0164320_100611104 | 3300013098 | Marine Sediment | MKRNKPNCGCLSKYMKSEFKGTKGSKGRGGWDAKPVFRITKPGRR* |
| Ga0164313_102905292 | 3300013101 | Marine Sediment | MKNKKNCGCFSKYMKPSVEGTKGSKGRNGWDAKPVFRITNPGRR* |
| Ga0164313_107981513 | 3300013101 | Marine Sediment | MKRNKPNCGCFSKYMKTPQVGVKGSKGRNGWDAKPVFRITNPGRR* |
| Ga0181387_10858951 | 3300017709 | Seawater | MKNKKNCGCLSKYMKPSMKGTKGSKGRNGWDAKPV |
| Ga0181390_10007667 | 3300017719 | Seawater | MKKKKANCGCFSKYMKPSIQGTKGSKGRNGWDAKPVFRITNPGRR |
| Ga0181390_10193704 | 3300017719 | Seawater | MKNKKANCGCFSKYMKPSIKGTKGSKGRNGWDAKPVFRITNPGRR |
| Ga0181401_10998393 | 3300017727 | Seawater | MKNKKNCGCFSKYMKPSIKGTKGSKGRNDWDAKPVFRITNPGRR |
| Ga0181399_10611854 | 3300017742 | Seawater | MKKKKANCGCFSKYMKPSIKGTKGSKGRNDWDAKPVFRITNPGRR |
| Ga0181389_10146478 | 3300017746 | Seawater | MKRNKPNCGCLSKYMKSELKGTKGSKGRNGWDAKPVFRITNPGRR |
| Ga0187219_10641541 | 3300017751 | Seawater | MKKKKANCGCFSKYMKPSIKGTKGSKGRNGWDAKP |
| Ga0181420_11068031 | 3300017757 | Seawater | MKNKKNCGCLSKYMKPSMKGTKGSKGRNGWDAKPVFRITN |
| Ga0192961_100158124 | 3300018980 | Marine | MKNKKNCGCLSKYMKPSIQGTKGSRGRNGWDAKPVFRITNPGKI |
| Ga0192961_102437261 | 3300018980 | Marine | LSKYMKTPQIGVKGSKGRNGWDAKPVFRITNPGRR |
| Ga0180037_11338708 | 3300019214 | Estuarine | MKNKKNCGCLSKYMKPSIQGTKGSKGRGGWDAKPVRRITNPGRR |
| Ga0206125_100292058 | 3300020165 | Seawater | MKRNKPNCGCLSKYMKSEFKGTKGSKGRNGWDAKPVFRITKPGRR |
| Ga0206128_100346311 | 3300020166 | Seawater | MKKKKANCGCFSKYMKPSVQGTKGSKGRNGWDAKPVFRITNPGRR |
| Ga0206131_103424693 | 3300020185 | Seawater | MKKSKLNCGCLSKYMKPAQTGTKGSKGRNGWDAKPVFRITNPRSR |
| Ga0211504_10653324 | 3300020347 | Marine | EENGTVNMKKKKANCGCFSKYMKSEFKGTKGSKGRNGWDAKPVFRITNPGRR |
| Ga0211686_1001208810 | 3300020382 | Marine | MKKSKPNCGCLSKYMKTAQTGTKGSKGRNGWDAKPVFRITNPGRR |
| Ga0206677_1000051124 | 3300021085 | Seawater | MKNKKNCGCLSKYMKPSMKGTKGSKGRNGWDAKPVFRITNPGRR |
| Ga0206682_1001346111 | 3300021185 | Seawater | MKNKKGNCGCLSKYMKPAQTGVKGSKGRNGWDAKPVFRITNPRNR |
| Ga0206682_100845391 | 3300021185 | Seawater | TVSMKKKKANCGCFSKYMKPSVQGTKGSKGRNGWDAKPVFRITNPGRR |
| Ga0213869_1000056224 | 3300021375 | Seawater | MKRNKPNCGCLSKYMKTPQIGVKGSKGRSGWDAKPVFRITNPGRR |
| Ga0213869_100153726 | 3300021375 | Seawater | MKNKKNCGCLSKYMKPSVKGTKGSKGRNGWDAKPVFRITNPGRR |
| Ga0222717_100031738 | 3300021957 | Estuarine Water | MKNKKNCGCLSKYMKPSIKGTKGSKGRNGWDAKPVFRITNPGRR |
| Ga0222717_100528105 | 3300021957 | Estuarine Water | MKNKKNCGCLSKYMKPSIKGVKGSKGRKGWDAKPVFRITNPGRR |
| Ga0222717_105029193 | 3300021957 | Estuarine Water | MKNKKNCGCLSKYMKPSIQGTKGSKGRGSWDAKPVRRITNPGRR |
| Ga0212030_10079933 | 3300022053 | Aqueous | MNKKKNNCGCLSKYMKSEFKGTKSSKGRNGWDAKPVFRITNPGRR |
| Ga0212023_10456072 | 3300022061 | Aqueous | MKNKKNCGCLSKYMKPSIQGTKGSKGRNGWDAKPVFRITNPGKI |
| Ga0212022_10424151 | 3300022164 | Aqueous | HEENGTVNMKKSKLNCGCLSKYMKPAQTGTKGSKGRNGWDAKPVFRITNPRNR |
| Ga0212022_10521233 | 3300022164 | Aqueous | MKNKKNCGCLSKYMKPSIKGAKGSKGRNGWDSKPVFRITNPGRR |
| Ga0224503_100475866 | 3300022201 | Sediment | MKNKKNCGCLSKYMKPSIQGTKGSKGRGSWDAKPVRRI |
| Ga0224513_100341333 | 3300022220 | Sediment | MKKKKANCGCFSKYMKPSVQGTKGSKGRNGWDAKPVFRVTNPGRR |
| Ga0224513_100734731 | 3300022220 | Sediment | CGCLSKYMKPSIQGTKGSKGRGGWDAKPVRRITNPGRR |
| Ga0222654_10461513 | 3300022836 | Saline Water | MKKNKPNCGCLSKYMKPAVQGTKGSKGRNGWDAKPVFRITNPGRR |
| (restricted) Ga0233404_100099978 | 3300022913 | Seawater | KNCGCLSKYMKPSIQGTKGSKERNGWDAKPVFRITNPGKI |
| (restricted) Ga0233408_100454374 | 3300023089 | Seawater | LSKYMKPSIQGTKGSKERNGWDAKPVFRITNPGKI |
| (restricted) Ga0233411_100588935 | 3300023112 | Seawater | MKNKKNCGCLSKYMKPSTQGTKGSKGRNGWDAKPVFRITNPGKI |
| (restricted) Ga0233411_100820694 | 3300023112 | Seawater | EENGTVNMKKSKLNCGCLSKYMKPAQTGVKGSKGRNGWDAKPVFRITNPRSR |
| (restricted) Ga0233412_100099843 | 3300023210 | Seawater | MNKKKNNCGCLSKYMKSEFKGTKGSKGRNGWDAKPVFTITNPGRR |
| (restricted) Ga0233412_100170628 | 3300023210 | Seawater | MKNKKNCGCLSKYMKPSIQGTKGSKERNGWDAKPVFRITNPGKI |
| (restricted) Ga0233412_100662311 | 3300023210 | Seawater | CLSKYMKPSTQGTKGSKGRNGWDAKPVFRITNPGKI |
| (restricted) Ga0233412_101566113 | 3300023210 | Seawater | NMKKSKLNCGCFSKYMKPSVQGTKGSKGRNGWDAKPVFRITNPGRR |
| (restricted) Ga0233410_100087976 | 3300023276 | Seawater | MNKKKNNCGCLSKYMKSEFKGTKGSKGRNGWDAKPVFRITNPGRR |
| (restricted) Ga0255039_101490515 | 3300024062 | Seawater | MKNKKNCGCLSKYMKPSIRGTKGSKGRNGWDAKPVFRITNPGKI |
| (restricted) Ga0233438_1000817510 | 3300024255 | Seawater | MKNKKNCGCLSKYMKPSIKGVKGSKGRNGWDAKPVFRITNPGRR |
| (restricted) Ga0255046_103024574 | 3300024519 | Seawater | SMKNKKNCGCLSKYMKPSIQGTKGSKERNGWDAKPVFRITNPGKI |
| (restricted) Ga0255046_106241351 | 3300024519 | Seawater | NCGCFSKYMKPSVQGTKGSKGRNGWDAKPVFRITNPGRR |
| Ga0209535_10730121 | 3300025120 | Marine | MKRNKPNCGCLSKYMKSEFKGTKGSKGRNGWDAKPVFRITNPGRR |
| Ga0208032_10158065 | 3300025266 | Deep Ocean | MKDKKSNCGCLSKYMKTAQTGTKGSKGRNGWDAKPVFRITNPGRR |
| Ga0208814_10137974 | 3300025276 | Deep Ocean | MKRSKPNCGCLSKYMKTAQTGTKGSKGRNGWDAKPVFRITNPGRR |
| Ga0208814_10146068 | 3300025276 | Deep Ocean | MKNKKNCGCLSKYMKPSIQGTKGSKGRNGWDAKPVYRITNPGRR |
| Ga0208814_10411833 | 3300025276 | Deep Ocean | MKDKKSNCGCLSKYMKTAQTGTKGSKGRDGWDAKPVFRITNPGRR |
| Ga0208814_10502244 | 3300025276 | Deep Ocean | MKGKKNCGCLSKYMKPSIQGTKGSKGRNKWDAKPVYRITNPGRR |
| Ga0208303_10044916 | 3300025543 | Aqueous | MKNKKNCGCLSKYMKPSVKGTKGSKGRNGWDAKPAFRITNPGRR |
| Ga0208643_11046271 | 3300025645 | Aqueous | NCGCLSKYMKPSVKGTKGSKGRNGWDAKPVFRITNPGRR |
| Ga0208922_10104736 | 3300027197 | Estuarine | MKPSIQGTKGSKGRGGWDAKPVRRITNPGRRLKRKQ |
| Ga0208922_10896483 | 3300027197 | Estuarine | KKNCGCLSKYMKPSIQGTKGSKGRGGWDAKPVRRITNPGRR |
| Ga0209383_12177921 | 3300027672 | Marine | HEENGIVSMKKNKPNCGCLSKYMKTAQTGTKGSKGRNGWDAKPVFRITNPGRR |
| Ga0209710_100406714 | 3300027687 | Marine | MKDKKSNCGCLSKYMKIAQTGIKGSKGRNGWDAKPVFRITRPGK |
| Ga0209710_10447754 | 3300027687 | Marine | MKRNKPNCGCLSKYMKTPQTGTKGSKGRNGWDAKPVFRITNPGRR |
| Ga0209710_10653933 | 3300027687 | Marine | MKRNKPNCGCLSKYMKTPQIGTKGSKGRNGWDAKPVFRITNPGRR |
| Ga0209192_101828223 | 3300027752 | Marine | MKKNKPNCGCLSKYMKTAQTGTKGSKGRNGWDAKPVFRITNPGKR |
| Ga0209273_100197481 | 3300027790 | Marine Sediment | TANMKNKKNCGCLSKYMKPSIQGTKGSKGRGGWDAKPVRRITNPGRR |
| Ga0209578_105117211 | 3300027820 | Marine Sediment | HEENGTVNMKNKKNCGCLSKYMKPSIQGTKGSKGRNGWDAKPVFRITNPGKI |
| Ga0209092_106135233 | 3300027833 | Marine | MKNKKNCGCLSKYMKPSIQGTKGSKGRNKWDAKPVYRITNPGRR |
| Ga0209013_101977064 | 3300027858 | Marine | MKNKKNCGYLSKYMKPSMKGTKGSKGRNGWDAKPVFRITNPGRR |
| (restricted) Ga0233415_100076479 | 3300027861 | Seawater | MKKKKANCGCFSKYMKPSIKGTKGSKGRNGWDAKPVFRITNPGRR |
| (restricted) Ga0233415_101636134 | 3300027861 | Seawater | MKNKKNCGCLSKYMKPSIQGTKGSKGRGGWDAKPVRRIT |
| (restricted) Ga0233415_106011442 | 3300027861 | Seawater | MKKSKLNCGCLSKYMKPAQAGTKGSKGRNGWDAKPVFIITNPRNR |
| (restricted) Ga0255055_102363815 | 3300027881 | Seawater | EPHEENGTANMKNKKNCGCLSKYMKPSIQGTKGSKGRGGWDAKPVRRITNPGRR |
| Ga0209272_100356751 | 3300027967 | Marine Sediment | CGCLSKYMKPSIQGTKGSKGRNGWDAKPVFRITNPGKI |
| Ga0209165_102614652 | 3300027978 | Marine Sediment | MNKKKNNCGCLSKYMKSEFKGTKSSKGRNGWDAKPVFRIT |
| (restricted) Ga0233413_100924311 | 3300027996 | Seawater | GTVSMKNKKNCGCLSKYMKPSIQGTKGSKERNGWDAKPVFRITNPGKI |
| Ga0256368_10210454 | 3300028125 | Sea-Ice Brine | MKNKRNCGCLSKYMKPSIQGTKGSKGRNGWDAKPVFRITNPGRR |
| Ga0257114_12350511 | 3300028196 | Marine | MKKSKLNCGCLSKYMKPAQAGTKGSKGRNGWDAKPVFRITNPRNR |
| Ga0308023_10049954 | 3300031167 | Marine | MKRNKPNCGCLSKYMKTPQTGVKGSKGRNGWDAKPVFRITNPGRR |
| Ga0307488_102894193 | 3300031519 | Sackhole Brine | MKNKKNCGCLSKYMKPSIQGTKGSKGRNGWDAKPVFRITNPGRR |
| Ga0307992_11523061 | 3300031601 | Marine | PNCGCLSKYMKTAQTGTKGSKGRNGWDAKPVFRITNPGRR |
| Ga0308014_11577473 | 3300031628 | Marine | EENGIVSMKRSKPNCGCLSKYMKTAQTGTKGSKGRNGWDAKPVFRITNPGRR |
| Ga0302125_101381693 | 3300031638 | Marine | KASKMKDKKSNCGCLSKYMKIAQTGIKGSKGRNGWDAKPVFRITRPGK |
| Ga0308003_12405113 | 3300031705 | Marine | ENGIASMKRNKPNCGCLSKYMKTPQTGVKGSKGRNGWDAKPVFRITNPGRR |
| Ga0315320_100484183 | 3300031851 | Seawater | MKKKKTNCGCFSKYMKTPQIGVKASKGRNGWDAKPVFRITNPGRR |
| Ga0314858_008842_1528_1662 | 3300033742 | Sea-Ice Brine | MKNKKNCGCFSKYMKPSIQGTKGSKGRNGWDAKPVFRITNPGRR |
| Ga0314858_028842_974_1108 | 3300033742 | Sea-Ice Brine | MKNNKNNCGCLSKYMKSSFKGTKGSKGRNGWDAKPVQRITNPGK |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |