NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0213922_1021734

Scaffold Ga0213922_1021734


Overview

Basic Information
Taxon OID3300021956 Open in IMG/M
Scaffold IDGa0213922_1021734 Open in IMG/M
Source Dataset NameFreshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1622
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (20.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater → Freshwater Microbial Communities From Mcnutts Creek, Athens, Georgia, United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)33.9263Long. (o)-83.4268Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F066594Metagenome / Metatranscriptome126N
F077447Metagenome / Metatranscriptome117N

Sequences

Protein IDFamilyRBSSequence
Ga0213922_10217342F066594N/AMRSPKLYIAAQEQLFAKFQSRSIAIQHWSKYLMTPKELALLFNKLEKSNSVLSEIAKTDLGRSGEIARKQLGIE
Ga0213922_10217343F077447N/AMRYKNLGNSSVEVELLSDDVEIRIGETKWSGVAYMREGKRKVYVRTKAEFKAKFVLIDAK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.