NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F066594

Metagenome / Metatranscriptome Family F066594

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F066594
Family Type Metagenome / Metatranscriptome
Number of Sequences 126
Average Sequence Length 72 residues
Representative Sequence MRSPKLYIAAQEQLFAKFQSRSIAIQHWSKYLMTPKELALLFQKLEKSNSVLREIAKTDLGQSGELARKQLGIE
Number of Associated Samples 109
Number of Associated Scaffolds 126

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.38 %
% of genes near scaffold ends (potentially truncated) 41.27 %
% of genes from short scaffolds (< 2000 bps) 74.60 %
Associated GOLD sequencing projects 103
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (93.651 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake
(17.460 % of family members)
Environment Ontology (ENVO) Unclassified
(56.349 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(56.349 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 81.08%    β-sheet: 0.00%    Coil/Unstructured: 18.92%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 126 Family Scaffolds
PF13481AAA_25 17.46
PF00436SSB 5.56
PF00285Citrate_synt 2.38
PF00271Helicase_C 1.59
PF04488Gly_transf_sug 0.79
PF02511Thy1 0.79
PF13604AAA_30 0.79

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 126 Family Scaffolds
COG0629Single-stranded DNA-binding proteinReplication, recombination and repair [L] 5.56
COG2965Primosomal replication protein NReplication, recombination and repair [L] 5.56
COG0372Citrate synthaseEnergy production and conversion [C] 2.38
COG1351Thymidylate synthase ThyX, FAD-dependent familyNucleotide transport and metabolism [F] 0.79
COG3774Mannosyltransferase OCH1 or related enzymeCell wall/membrane/envelope biogenesis [M] 0.79


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.41 %
UnclassifiedrootN/A1.59 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002835|B570J40625_100816343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3818Open in IMG/M
3300003277|JGI25908J49247_10000078All Organisms → cellular organisms → Bacteria25046Open in IMG/M
3300003277|JGI25908J49247_10069222All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3886Open in IMG/M
3300003411|JGI25911J50253_10220235All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3518Open in IMG/M
3300003412|JGI25912J50252_10038176All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31393Open in IMG/M
3300003413|JGI25922J50271_10008734All Organisms → cellular organisms → Bacteria2772Open in IMG/M
3300003493|JGI25923J51411_1069191All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3613Open in IMG/M
3300003497|JGI25925J51416_10016600All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar32198Open in IMG/M
3300003860|Ga0031658_1032215All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3889Open in IMG/M
3300003860|Ga0031658_1042997All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3775Open in IMG/M
3300003860|Ga0031658_1084214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3568Open in IMG/M
3300004481|Ga0069718_16033680All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31482Open in IMG/M
3300005581|Ga0049081_10148544All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3858Open in IMG/M
3300005582|Ga0049080_10084211All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31086Open in IMG/M
3300005805|Ga0079957_1000316All Organisms → cellular organisms → Bacteria41661Open in IMG/M
3300006030|Ga0075470_10001086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar38490Open in IMG/M
3300006030|Ga0075470_10044399All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31367Open in IMG/M
3300006802|Ga0070749_10178188All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31225Open in IMG/M
3300006802|Ga0070749_10180692All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31215Open in IMG/M
3300007363|Ga0075458_10096284All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3922Open in IMG/M
3300007734|Ga0104986_1911All Organisms → cellular organisms → Bacteria44980Open in IMG/M
3300007973|Ga0105746_1184209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3710Open in IMG/M
3300008110|Ga0114343_1105487All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3968Open in IMG/M
3300008114|Ga0114347_1045301All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar33481Open in IMG/M
3300008262|Ga0114337_1196541All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3826Open in IMG/M
3300008448|Ga0114876_1010197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar35404Open in IMG/M
3300009039|Ga0105152_10104315All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31153Open in IMG/M
3300009068|Ga0114973_10021952All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar33950Open in IMG/M
3300009075|Ga0105090_10336977All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3922Open in IMG/M
3300009081|Ga0105098_10615997All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3567Open in IMG/M
3300009085|Ga0105103_10819007All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3541Open in IMG/M
3300009157|Ga0105092_10030940All Organisms → Viruses → Predicted Viral2838Open in IMG/M
3300009160|Ga0114981_10532503All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3627Open in IMG/M
3300009163|Ga0114970_10114457All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31655Open in IMG/M
3300009163|Ga0114970_10284450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3946Open in IMG/M
3300009165|Ga0105102_10909351All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3508Open in IMG/M
3300009168|Ga0105104_10099492All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31566Open in IMG/M
3300009168|Ga0105104_10413214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3751Open in IMG/M
3300009184|Ga0114976_10309141All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3844Open in IMG/M
3300010354|Ga0129333_10350649All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31313Open in IMG/M
3300011268|Ga0151620_1018487All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar32440Open in IMG/M
3300013005|Ga0164292_10292470All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31117Open in IMG/M
(restricted) 3300013122|Ga0172374_1194134All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3737Open in IMG/M
(restricted) 3300013127|Ga0172365_10428599All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3770Open in IMG/M
(restricted) 3300013128|Ga0172366_10192213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31311Open in IMG/M
(restricted) 3300013130|Ga0172363_10221259All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31275Open in IMG/M
(restricted) 3300013131|Ga0172373_10274794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31099Open in IMG/M
3300017701|Ga0181364_1036737All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3787Open in IMG/M
3300017707|Ga0181363_1086950All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3532Open in IMG/M
3300017722|Ga0181347_1051184All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31247Open in IMG/M
3300017747|Ga0181352_1054998All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31150Open in IMG/M
3300017778|Ga0181349_1008926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar34186Open in IMG/M
3300017778|Ga0181349_1236187All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3616Open in IMG/M
3300017785|Ga0181355_1186604All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3821Open in IMG/M
3300017785|Ga0181355_1279892All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3632Open in IMG/M
3300017788|Ga0169931_10235760All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31512Open in IMG/M
3300019781|Ga0181360_111018All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3752Open in IMG/M
3300019784|Ga0181359_1002371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar35441Open in IMG/M
3300019784|Ga0181359_1096311All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31090Open in IMG/M
3300020141|Ga0211732_1047738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31365Open in IMG/M
3300020162|Ga0211735_10615933All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31149Open in IMG/M
3300020162|Ga0211735_10707671All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3781Open in IMG/M
3300020183|Ga0194115_10029030All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar33974Open in IMG/M
3300020510|Ga0208086_1030928All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3649Open in IMG/M
3300020515|Ga0208234_1037023All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3544Open in IMG/M
3300020530|Ga0208235_1002411All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar32958Open in IMG/M
3300020544|Ga0207937_1034228All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3759Open in IMG/M
3300020549|Ga0207942_1009698All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31296Open in IMG/M
3300020550|Ga0208600_1044954All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3669Open in IMG/M
3300020564|Ga0208719_1039360All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3880Open in IMG/M
3300020571|Ga0208723_1045592All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3614Open in IMG/M
3300021519|Ga0194048_10085719All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31224Open in IMG/M
3300021601|Ga0194061_1012356All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar33537Open in IMG/M
3300021956|Ga0213922_1021734All Organisms → Viruses → Predicted Viral1622Open in IMG/M
3300021962|Ga0222713_10204193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31319Open in IMG/M
3300021963|Ga0222712_10456636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3765Open in IMG/M
3300022173|Ga0181337_1001385All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar32545Open in IMG/M
3300022190|Ga0181354_1124309All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3827Open in IMG/M
3300022752|Ga0214917_10035733All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar33623Open in IMG/M
3300024549|Ga0256308_1063594All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3786Open in IMG/M
3300025896|Ga0208916_10536559All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3509Open in IMG/M
3300027130|Ga0255089_1001219Not Available7869Open in IMG/M
3300027135|Ga0255073_1014663All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31434Open in IMG/M
3300027141|Ga0255076_1001068All Organisms → cellular organisms → Bacteria6090Open in IMG/M
3300027141|Ga0255076_1012869All Organisms → Viruses → Predicted Viral1601Open in IMG/M
3300027503|Ga0255182_1036664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31343Open in IMG/M
3300027586|Ga0208966_1025118All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31750Open in IMG/M
3300027608|Ga0208974_1127720All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3660Open in IMG/M
3300027722|Ga0209819_10044044All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31526Open in IMG/M
3300027733|Ga0209297_1199202All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3795Open in IMG/M
3300027743|Ga0209593_10147087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3848Open in IMG/M
3300027756|Ga0209444_10001462All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar313001Open in IMG/M
3300027798|Ga0209353_10359081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3606Open in IMG/M
3300027805|Ga0209229_10015152All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar33282Open in IMG/M
3300027899|Ga0209668_10458109All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3841Open in IMG/M
3300027969|Ga0209191_1127475All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31058Open in IMG/M
3300028025|Ga0247723_1002074Not Available11032Open in IMG/M
3300028025|Ga0247723_1019781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar32295Open in IMG/M
3300029930|Ga0119944_1032150All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3672Open in IMG/M
3300031746|Ga0315293_10644127All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3796Open in IMG/M
3300031784|Ga0315899_10237548All Organisms → Viruses → Predicted Viral1823Open in IMG/M
3300031787|Ga0315900_10049817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar34429Open in IMG/M
3300031834|Ga0315290_11180806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3636Open in IMG/M
3300031857|Ga0315909_10115114All Organisms → Viruses → Predicted Viral2286Open in IMG/M
3300031873|Ga0315297_11016104All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3685Open in IMG/M
3300031885|Ga0315285_10207611All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31555Open in IMG/M
3300032164|Ga0315283_10226481All Organisms → Viruses → Predicted Viral2017Open in IMG/M
3300032173|Ga0315268_11728717All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3638Open in IMG/M
3300033233|Ga0334722_10390725All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31005Open in IMG/M
3300033521|Ga0316616_100252128All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31820Open in IMG/M
3300033816|Ga0334980_0228664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3738Open in IMG/M
3300033816|Ga0334980_0258935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3683Open in IMG/M
3300033978|Ga0334977_0209689All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3976Open in IMG/M
3300033993|Ga0334994_0059557All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar32351Open in IMG/M
3300033993|Ga0334994_0082167All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31929Open in IMG/M
3300033993|Ga0334994_0087607All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31853Open in IMG/M
3300033993|Ga0334994_0233742All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3972Open in IMG/M
3300034012|Ga0334986_0133960All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31447Open in IMG/M
3300034061|Ga0334987_0013881All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar37396Open in IMG/M
3300034092|Ga0335010_0081669All Organisms → cellular organisms → Bacteria2205Open in IMG/M
3300034101|Ga0335027_0012247All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar37407Open in IMG/M
3300034106|Ga0335036_0398183All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3885Open in IMG/M
3300034118|Ga0335053_0124231All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31764Open in IMG/M
3300034200|Ga0335065_0001622All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar316067Open in IMG/M
3300034283|Ga0335007_0586004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3648Open in IMG/M
3300034356|Ga0335048_0095172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31801Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake17.46%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater16.67%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment7.94%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment7.14%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater6.35%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake5.56%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater4.76%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous4.76%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic3.17%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment3.17%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater3.17%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton2.38%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater2.38%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater1.59%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.59%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.59%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment1.59%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.79%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.79%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment0.79%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.79%
Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment0.79%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.79%
AquaticEnvironmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic0.79%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater0.79%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.79%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.79%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.79%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003277Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SDEnvironmentalOpen in IMG/M
3300003411Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SDEnvironmentalOpen in IMG/M
3300003412Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DDEnvironmentalOpen in IMG/M
3300003413Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DDEnvironmentalOpen in IMG/M
3300003493Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SNEnvironmentalOpen in IMG/M
3300003497Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DNEnvironmentalOpen in IMG/M
3300003860Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PLEnvironmentalOpen in IMG/M
3300004481Combined Assembly of Gp0112041, Gp0112042, Gp0112043EnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300005582Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRFEnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300006030Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300007363Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNAEnvironmentalOpen in IMG/M
3300007734Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015JanEnvironmentalOpen in IMG/M
3300007973Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2umEnvironmentalOpen in IMG/M
3300008110Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NAEnvironmentalOpen in IMG/M
3300008114Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NAEnvironmentalOpen in IMG/M
3300008262Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NAEnvironmentalOpen in IMG/M
3300008448Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigsEnvironmentalOpen in IMG/M
3300009039Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cmEnvironmentalOpen in IMG/M
3300009068Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaGEnvironmentalOpen in IMG/M
3300009075Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015EnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009085Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009160Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaGEnvironmentalOpen in IMG/M
3300009163Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaGEnvironmentalOpen in IMG/M
3300009165Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009184Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaGEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300011268Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555EnvironmentalOpen in IMG/M
3300013005Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaGEnvironmentalOpen in IMG/M
3300013122 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3mEnvironmentalOpen in IMG/M
3300013127 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cmEnvironmentalOpen in IMG/M
3300013128 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 69cmEnvironmentalOpen in IMG/M
3300013130 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2EnvironmentalOpen in IMG/M
3300013131 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10mEnvironmentalOpen in IMG/M
3300017701Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300017707Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.NEnvironmentalOpen in IMG/M
3300017722Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017747Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.NEnvironmentalOpen in IMG/M
3300017778Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300017788Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20LEnvironmentalOpen in IMG/M
3300019781Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM15.S.DEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020141Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1EnvironmentalOpen in IMG/M
3300020162Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1EnvironmentalOpen in IMG/M
3300020183Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surfaceEnvironmentalOpen in IMG/M
3300020510Freshwater microbial communities from Lake Mendota, WI - 06JUL2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020515Freshwater microbial communities from Lake Mendota, WI - 27SEP2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020530Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020544Freshwater microbial communities from Lake Mendota, WI - 04SEP2011 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020549Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020550Freshwater microbial communities from Lake Mendota, WI - 08OCT2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020564Freshwater microbial communities from Lake Mendota, WI - 30JUL2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020571Freshwater microbial communities from Lake Mendota, WI - 31AUG2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021519Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5mEnvironmentalOpen in IMG/M
3300021601Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L224-21mEnvironmentalOpen in IMG/M
3300021956Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MGEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022173Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM15.D.DEnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300022752Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BBEnvironmentalOpen in IMG/M
3300024549Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025896Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027130Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8dEnvironmentalOpen in IMG/M
3300027135Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8hEnvironmentalOpen in IMG/M
3300027141Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8hEnvironmentalOpen in IMG/M
3300027503Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepA_8dEnvironmentalOpen in IMG/M
3300027586Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027608Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027722Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027733Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027743Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027756Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027798Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027805Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300027969Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300028025Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FCEnvironmentalOpen in IMG/M
3300029930Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727EnvironmentalOpen in IMG/M
3300031746Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300031885Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36EnvironmentalOpen in IMG/M
3300032164Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300033233Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottomEnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300033816Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005EnvironmentalOpen in IMG/M
3300033978Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002EnvironmentalOpen in IMG/M
3300033993Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037EnvironmentalOpen in IMG/M
3300034012Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027EnvironmentalOpen in IMG/M
3300034061Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028EnvironmentalOpen in IMG/M
3300034092Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069EnvironmentalOpen in IMG/M
3300034101Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107EnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M
3300034118Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165EnvironmentalOpen in IMG/M
3300034200Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190EnvironmentalOpen in IMG/M
3300034283Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061EnvironmentalOpen in IMG/M
3300034356Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
B570J40625_10081634323300002835FreshwaterMRSPSHYIAAQEQLFAKFKSRSIPIQQWSKYLMTPKELALLFQKLEKSNSVLQEIAKTDLGRSGELARKQLGIE*
JGI25908J49247_10000078213300003277Freshwater LakeMRSPKLYITAQEQLFAKFQSRSIAIQHWSKYLMTPKELALLFSKLEKSNSVLSEIAKTDLGKSGELARKQLGIE*
JGI25908J49247_1006922223300003277Freshwater LakeMRHPDLYIDAQSKLFAKFQTRSIRIHHWSKYLMTPKELALLFGKLEKSNSVLREIAKTDLGKSGELARKQLGIE*
JGI25911J50253_1022023513300003411Freshwater LakeQSKLFAKFQTRSIRIHHWSKYLMTPKELALLFGKLEKSNSVLREIAKTDLGKSGELARKQLGIE*
JGI25912J50252_1003817623300003412Freshwater LakeLNKHPKLYIAAQEQLFAKFQSRSIPIQHWSKYLMTPKELSLLFAKFEESKSVLQQIASNDLGESGDIARKQLGIQ*
JGI25922J50271_1000873423300003413Freshwater LakeMRSPKLYIAAQEQLFAKFQSRSIAIQHWSKYLMTPKELALLFSKLEKSNSVLSEIAKTDLGRSGEIARKQLGIE*
JGI25923J51411_106919113300003493Freshwater LakeLNKHPKLYIAAQEQLFAKFQSRSIPIQHWSKYLMTPKELSLLFAKFEELKSVLQQIASNDLGESGDIA
JGI25925J51416_1001660063300003497Freshwater LakeLNKHPKLYIAAQEQLFAKFQSRSIPIQHWSKYLMTPKELSLLFAKFEESKSVLQQIASNDLGESGDIARKQLGIK*
Ga0031658_103221523300003860Freshwater Lake SedimentMRSPNLYIGAQEQLFAKFQSRSIAIQHWSKYLMTPKELALLFSKLEKSNSVLSEIAKTDLGRSGELARKQLGIE*
Ga0031658_104299713300003860Freshwater Lake SedimentVISPDHYIAAQEQLFGKFQNRSIKIQHWSKYLITPKELALLFKKLEEHKSVIRQIATTDIGKSGDIARKHLGI*
Ga0031658_108421423300003860Freshwater Lake SedimentMRSPDHYIAAQEQLFAKFQSRSIAIQHWSKYLMTPKELALLFRKLEKSNSVLQEIARTDLGKSGELARKQLGIQ*
Ga0069718_1603368023300004481SedimentMRSPSHYIAAQEQLFAKFKSRSIPIQQWSKYLMTPKELALLFQKLEKSNSVLQDIAKTDLGRSGELARKQLGIE*
Ga0049081_1014854413300005581Freshwater LenticMRSPSHYIAAQEQLFAKFKSRSIPIQQWSKYLMTPKELSLLFQKLEKSNSVLQEIAKTDLGRSGELARKQLGIE*
Ga0049080_1008421113300005582Freshwater LenticRSLNKHPKLYIAAQEQLFAKFQSRSIPIQHWSKYLMTPKELSLLFAKFEESKSVLQQIASNDLGESGDIARKQLGIQ*
Ga0079957_100031673300005805LakeMRSPNLYIGAQEQLFAKFQSRSIAIQHWSKYLMTPKELALLFRKLEKSNSVLSEIAKTDLGRSGELARKQLGIE*
Ga0075470_10001086173300006030AqueousVISPDHYIAAQEQLFGKFQNRSIKIQHWSKYLITPKELALLFRKLEEHKSVIRQIATTDIGKSGDIARKHLGI*
Ga0075470_1004439923300006030AqueousMLHPETYITAQEQLFQKFQDRSIPIRHWSKYLMTPKELAVLFRKLEQSNSVLKEIASTDLGRSGELARKQLGIQ*
Ga0070749_1017818823300006802AqueousSPDHYIAAQEQLFGKFQNRSIKIQHWSKYLITPKELALLFKKLEEHKSVIRQIATTDIGKSGDIARKHLGI*
Ga0070749_1018069223300006802AqueousDHYIAAQEQLFGKFQNRSIKIQHWSKYLITPKELALLFRKLEEHKSVIRQIATTDIGKSGDIARKHLGI*
Ga0075458_1009628423300007363AqueousMRSPDHYIAAQEQLFAKFQSRSIAIQHWSKYLMTPKELALLFRKLDKSNSVLQEIAKTDLGKSGELARKQLGIQ*
Ga0104986_1911123300007734FreshwaterLNKHPKLYIAAQEQLFAKFQSRSIPIQHWSKYLMTPKELSLLFLKLEESKSVLHQIAITDLGESGELARKQLGIQ*
Ga0105746_118420923300007973Estuary WaterMRSPKLYIAAQEQLFAKFQSRSIAIQHWSKYLMTPKELALLFSKLEKSNSVLSEIAKTDLGRSGDIARKQLGIE*
Ga0114343_110548723300008110Freshwater, PlanktonMRSPSHYIAAQEQLFAKFKSRSIPIQQWSKYLMTPKVLALLFQKLEKSNSVLQDIAKTDLGKSGELARKQLGIE*
Ga0114347_104530123300008114Freshwater, PlanktonMRSPSHYIAAQEQLFAKFKSRSIPIQQWSKYLMTPKELALLFQKLEKSNSVLQDIAKTDLGKSGELARKQLGIE*
Ga0114337_119654123300008262Freshwater, PlanktonQEQLFAKFKSRSIPIQQWSKYLMTPKELALLFQKLEKSNSVLQDIAKTDLGKSGELARKQLGIE*
Ga0114876_1010197113300008448Freshwater LakeMLHPETYIAAQEQLFRKFQDRSIPIRHWSKYLMTPKELALLFKKLDQSNSVLREIAITDMGRSGELARKQLGI*
Ga0105152_1010431543300009039Lake SedimentLNKHPKLYIAAQEQLFAKFQSRSIQIQHWSKYLMTPKELSLLFLKLEESKSALQQIAITDLGESGEIARKQLGIQ*
Ga0114973_1002195223300009068Freshwater LakeLNKHPKLYIAAQEQLFAKFQSRSIPIQHWSKYLMTPKELSLLFLKLEESKSVLQQIAITDLGESGELARKQLGIQ*
Ga0105090_1033697733300009075Freshwater SedimentMRSPNLYIAAQEQLFAKFQSRSIAIQHWSKYLMTPKELALLFQKLEKSNSVLREIAKTDLGQSGELARKQLGIE*
Ga0105098_1061599723300009081Freshwater SedimentFPSRSIAIQHWSKYLMTPKELALLFQESEKSNSVLRELAKTDLGQSGELARKQLGIE*
Ga0105103_1081900713300009085Freshwater SedimentLYITAQEQLFAKFQSRSIAIQHWSKYLMTPKELALLFQKLEKSNCVLREIAKTDLGQSGELARKQLGIE*
Ga0105092_1003094073300009157Freshwater SedimentMRSPKLYITAQEQLFAKFQSRSIAIQHWSKYLMTPKELALLFQKLEKSNSVLREIAKTDLGQSGELARKQLGIE*
Ga0114981_1053250323300009160Freshwater LakeLNKHPKLYIAAQEQLFAKFQSRSIPIQHWSKYLMTPKELSLLFLKLEESKSVLQQIASNDLGESGDIARKQLGIQ*
Ga0114970_1011445713300009163Freshwater LakeLNKHPKLYIAAQEQLFAKFQSRSIPIQHWSKYLMTPKELSLLFLKLEESKSVLQQIAITDLGESG
Ga0114970_1028445013300009163Freshwater LakeKLYIAAQEQLFAKFQSRSIPIQHWSKYLMTPKELSLLFSKLEESKSVLQQIASNDLGESGDIARKQLGVQ*
Ga0105102_1090935113300009165Freshwater SedimentKEQLFAKFQSRSIAIQHWSKYLMTPKELALLFQKLEKSNCVLREIAKTDLGQSGELARKQLGIE*
Ga0105104_1009949223300009168Freshwater SedimentQEQLFAKFQSRSIAIQHWSKYLMTPKELALLFQKLEKSNSVLREIAKTDLGQSGELARKQLGIE*
Ga0105104_1041321413300009168Freshwater SedimentQLFAKFQSRSIAIQHWSKYLMTPKELALLFQKLEKSNCVLREIAKTDLGQSGELARKQLGIE*
Ga0114976_1030914143300009184Freshwater LakeLNKHPKLYIAAQEQLFAKFQSRSIPIQHWSKYLMTPKELSLLFLKLEESKSVLQQIAITDLGESGEL
Ga0129333_1035064913300010354Freshwater To Marine Saline GradientMRSPSHYIAAQEQLFAKFKSRSIPIQQWSKYLMTPKELALLFQKLEKSNSVLQEIAKTDLGRSGELARKQ
Ga0151620_101848753300011268FreshwaterMRSPDHYIAAQEQLFAKFQSRSIAIQHWSKYLMTPKELALLFRKLEKSNSVLSEIAKTDLGRSGEIARKQLGIE*
Ga0164292_1029247043300013005FreshwaterMRSPSHYITAQEQLFAKFKSRSIPIQQWSKYLMTPKELSLLFQKLEKSNSVLQDIAKTDLGRSGELARKQLGIE*
(restricted) Ga0172374_119413413300013122FreshwaterMLSPDIYITAQEQLFRKFQDRSIPIRHWSKYLITPKELILLFKKLEKSNSVLQEIASTDLGPSGELARKQLGIK*
(restricted) Ga0172365_1042859923300013127SedimentMLSPDIYIAAQEQLFRKFQDRSIPIRHWSKYLITPKELALLFTKLEKSNSVLQEIASTDLGPSGELARKQLGIK*
(restricted) Ga0172366_1019221323300013128SedimentMLSPDIYITAQEQLFRKFQDRSIPIRHWSKYLITPKELALLFTKLEKSNSVLQEIASTDLGPSGELARKQLGIK*
(restricted) Ga0172363_1022125923300013130SedimentMLSPDIYITAQEQLFRKFQDRSIPIRHWSKYLITPKELILLFKKLEKSNSVLQEIASTDLGPSEELARKQLGIK*
(restricted) Ga0172373_1027479423300013131FreshwaterMLSPDIYITAQEHLFRKFQDRSIPIRHWSKYLITPKELALLFTKLEKSNSVLQEIASTDLGPSGELARKQLGIK*
Ga0181364_103673723300017701Freshwater LakePNSRPSSSRSLNKHPKLYIAAQEQLFAKFQSRSIPIQHWSKYLMTPKELSLLFAKFEESKSVLQQIASNDLGESGDIARKQLGIQ
Ga0181363_108695023300017707Freshwater LakeSPDHYIAAQEQLFGKFQNRSIKIQHWSKYLITPKELALLFKKLEEHKSVIRQIATTDIGKSGDIARKHLGI
Ga0181347_105118423300017722Freshwater LakeMRSPSHYITAQEQLFAKFQSRSIAIQHWSKYLMTPKELALLFSKLEKSNSVLSEIAKTDLGKSGELARKQLGIE
Ga0181352_105499823300017747Freshwater LakeQLFAKFKSRSIPIQQWSKYLMTPKELSLLFQKLEKSNSVLQDIAKTDLGRSGELARKQLGIE
Ga0181349_100892623300017778Freshwater LakeMRSPSHYITAQEQLFAKFKSRSIPIQQWSKYLMTPKELALLFQKLEKSNSVLREIAKTDLGKSGELARKQLGIE
Ga0181349_123618723300017778Freshwater LakeAAQEQLFAKFQSRSIPIQHWSKYLMTPKELSLLFQKLEKSNSVLQDIAKTDLGKSGELARKQLGIE
Ga0181355_118660413300017785Freshwater LakeRCTFERRPNSRPSSSRSLNKHPKLYIAAQEQLFAKFQSRSIPIQHWSKYLMTPKELSLLFAKFEESKSVLQQIASNDLGESGDIARKQLGIQ
Ga0181355_127989213300017785Freshwater LakeRSLNKHPKLYIAAQEQLFAKFQSRSIPIQHWSKYLMTPKELSLLFAKFEELKSVLQQIASNDLGESGDIARKQLGIK
Ga0169931_1023576033300017788FreshwaterMLSPDIYITAQEQLFRKFQDRSIPIRHWSKYLITPKELILLSKKLEKSNSVLQEIASTDLGPSGELARKQLGIK
Ga0181360_11101823300019781Freshwater LakeMRHPDLYIDAQSKLFAKFQTRSIRIHHWSKYLMTPKELALLFGKLEKSNSVLREIAKTDLGKSGELARKQLGIE
Ga0181359_100237193300019784Freshwater LakeMRSPKLYITAQEQLFAKFQSRSIAIQHWSKYLMTPKELALLFSKLEKSNSVLSEIAKTDLGKSGELARKQLGIE
Ga0181359_109631123300019784Freshwater LakeLNKHPKLYIAAQEQLFAKFQSRSIPIQHWSKYLMTPKELSLLFAKFEELKSVLQQIASNDLGESGDIARKQLGIK
Ga0211732_104773863300020141FreshwaterLNKHPKLYIAAQEQLFAKFQSRSIPIQHWSKYLMTPKELSLLFLKLEESKSVLQQIAITDLGESGELARKQLGIQ
Ga0211735_1061593323300020162FreshwaterLNKHPKLYIAAQEQLFAKFQSRSIPIQHWSKYLMTPKELSLLFLKLEESKSVLQQIAITDLGESGELARKQLGIE
Ga0211735_1070767123300020162FreshwaterSKPSSSRSLNKHPKLYIAAQEQLFAKFHSRSIPIQHWSKHLMTPKELSLLFLKLEESKSVLQQIAITDLGESGELARKQLGIE
Ga0194115_1002903053300020183Freshwater LakeMLSPDIYITAQEQLFRKFQDRSIPIRHWSKYLITPKELALLFKRLEKSNSVLQEIASTDLGPSGELARKQLGIK
Ga0208086_103092813300020510FreshwaterLNKHPKLYIAAQEQLFAKFQSRSIAIQHWSKYLMTPKELALLFQKLEKSNSVLREIAKTDLGQSGELARKQLGIE
Ga0208234_103702323300020515FreshwaterMRSPKLYIAAQEQLFAKFQSRSIAIQHWSKYLMTPKELALLFQKLEKSNSVLREIAKTDLGQSGELARKQLGIE
Ga0208235_100241163300020530FreshwaterMRSPNLYIAAQEQLFAKFQSRSIAIQHWSKYLMTPKELALLFSKLEKSNSVLSEIAKTDLGRSGEIARKQLGIE
Ga0207937_103422823300020544FreshwaterMRSPKLYIAAQEQLFAKFQSRSIAIQHWSKYLMTPKELALLFSKLEKSNSVLSEIAKTDLGRSGEIARKQLGFE
Ga0207942_100969813300020549FreshwaterEQLFAKFQSRSIAIQHWSKYLMTPKELALLFQKLEKSNCVLREIAKTDLGQSGELARKQLGIE
Ga0208600_104495413300020550FreshwaterKLYIAAQEQLFAKFQSRSIPIQHWSKYLMTPKELSLLFAKFEESKSVLQQIASNDLGESGDIARKQLGIQ
Ga0208719_103936023300020564FreshwaterMRSPKLYIAAQEQLFAKFQSRSIPIQHWSKYLMTPKELSLLFAKFEESKSVLQQIASNDLGESGDIARKQLGIQ
Ga0208723_104559233300020571FreshwaterMRSPKLYIAAQEQLFAKFQSRSIAIQHWSKYLMTPKELALLFSKLEKSNSVLSEIAKTDLGRSGE
Ga0194048_1008571923300021519Anoxic Zone FreshwaterLNKHPKLYIAAQEQLFAKFQSRSIPIQHWSKYLMTPKELSLLFAKFEESKSVLQQIAITDLGESGELARKQLGIQ
Ga0194061_101235643300021601Anoxic Zone FreshwaterMRHPDLYIDAQSKLFAKFQTRSIRIHHWSKYLMTPKELALLFVKLEKSNSVLREIAKTDLGKSGELARKQLGIE
Ga0213922_102173423300021956FreshwaterMRSPKLYIAAQEQLFAKFQSRSIAIQHWSKYLMTPKELALLFNKLEKSNSVLSEIAKTDLGRSGEIARKQLGIE
Ga0222713_1020419323300021962Estuarine WaterMRSPKLYIAAQEQLFAKFQSRSIAIQHWSKYLMTPKELALLFSKLEKSNSVLSEIAKTDLGRSGDIARKQLGIE
Ga0222712_1045663613300021963Estuarine WaterLYIAAQEQLFAKFKSRSIAIQHWSKHLMTPKELALLFRTIEKSKLALQKIAESDLGESGDIARKQLGIE
Ga0181337_100138543300022173Freshwater LakePKLYITAQEQLFAKFQSRSIAIQHWSKYLMTPKELALLFSKLEKSNSVLSEIAKTDLGKSGELARKQLGIE
Ga0181354_112430913300022190Freshwater LakeMRSPSHYIAAQEQLFAKFKSRSIPIQQWSKYLMTPKELALLFQKLEKSNSVLQDIAKTDLGKSGELARKQLGIE
Ga0214917_1003573323300022752FreshwaterVISPDHYIAAQEQLFGKFQNRSIKIQHWSKYLITPKELALLFKKLEEHKSVIRQIATTDIGKSGDIARKHLGI
Ga0256308_106359433300024549FreshwaterMRSPKLYIAAQEQLFAKFQSRSIAIQHWSKYLMTPKELALLFSKLEKSNSVLSEIAKTDLGRSGDIARKK
Ga0208916_1053655913300025896AqueousMRSPKLYIAAQEQLFGKFQNRSIKIQHWSKYLITPKELTLLFRKLEEHKSVIRQIATTDIGKSGDIARKHLGI
Ga0255089_100121983300027130FreshwaterDHYIAAQEQLFAKFQSRSIAIQHWSKYLMTPKELALLFRKLEKSNSVLQEIARTDLGKSGELARKQLGIQ
Ga0255073_101466343300027135FreshwaterMRSPKLYIAAQEQLFAKFQSRSIAIQHWSKYLMTPKELALLFRKLEKSNSVLQEIARTDLGKSGELARKQLGIQ
Ga0255076_100106863300027141FreshwaterPDHYIAAQEQLFAKFQSRSIAIQHWSKYLMTPKELALLFRKLEKSNSVLQEIARTDLGKSGELARKQLGIQ
Ga0255076_101286913300027141FreshwaterPKLYIAAQEQLFAKFQSRSIAIQHWSKYLMTPKELALLFSKLEKSNSVLSEIAKTDLGRSGDIARKQLGIE
Ga0255182_103666413300027503FreshwaterMLHPETYIAAQEQLFRKFQDRSIPIRHWSKYLMTPKELALLFKKLDQSNSVLREIGATDIGHSGELARKQLGIQ
Ga0208966_102511823300027586Freshwater LenticLNKHPKLYIAAQEQLFAKFQSRSIPIQHWSKYLMTPKELSLLFAKFEESKSVLQQIASNDLGESGDIARKQLGIQ
Ga0208974_112772013300027608Freshwater LenticMRSPSHYIAAQEQLFAKFKSRSIPIQQWSKYLMTPKELALLFQKLEKSNSVLQEIAKTDLGRSGELARKQLGIE
Ga0209819_1004404423300027722Freshwater SedimentMRSPKLYITAQEQLFAKFQSRSIAIQHWSKYLMTPKELALLFQKLEKSNCVLREIAKTDLGQSGELARKQLGIE
Ga0209297_119920223300027733Freshwater LakeQEQLFAKFQSRSIPIQHWSKYLMTPKELSLLFAKFEESKSVLQQIASNDLGESGDIARKQLGIK
Ga0209593_1014708723300027743Freshwater SedimentAAQEQLFAKFQSRSIAIQHWSKYLMTPKELALLFQKLEKSNCVLREIAKTDLGQSGELARKQLGIE
Ga0209444_10001462103300027756Freshwater LakeLNKHPKLYIAAQEQLFAKFQSRSIPIQHWSKYLMTPKELSLLFAKFEESKSVLQQIASNDLGESGDIARKQLGIK
Ga0209353_1035908123300027798Freshwater LakePALCFGTRNLTLLNRSPKLYITAQEQLFAKFKSRSIAIQHWSKHLMTPKELALLFRTIEKSKLALQKIAESDLGESGDIARKQLGIE
Ga0209229_1001515263300027805Freshwater And SedimentMRSPDHYIAAQEQLFAKFQSRSIAIQHWSKYLMTPKELALLFRKLDKSNSVLQEIAKTDLGKSGELARKQLGIQ
Ga0209668_1045810933300027899Freshwater Lake SedimentMRSPNLYIAAQEQLFAKFQSRSIAIQHWSKYLMTPKELALLFQKLEKSNCVLREIAKTDLGQSGELARKQLGIE
Ga0209191_112747523300027969Freshwater LakeLNKHPKLYIAAQEQLFAKFQSRSIPIQHWSKYLMTPKELSLLFLKLEESKSVLQQIASNDLGESGDIARKQLGIQ
Ga0247723_100207413300028025Deep Subsurface SedimentEQLFAKFKSRSIPIQQWSKYLMTPKELALLFQKLEKSNSVLQDIAKTDLGKSGELARKQLGIE
Ga0247723_101978133300028025Deep Subsurface SedimentEQLFAKFKSRSIPIQQWSKYLMTPKELALLFQKLEKSNSVLQDIAKTDLGRSGELARKQLGIE
Ga0119944_103215033300029930AquaticMLHPETYITAQEQLFRKFQDRSIPIRHWSKYLMTPKELAVLFRKLEQSNSVLKEIASTDLGRSGELARKQLGIQ
Ga0315293_1064412723300031746SedimentAQEQLFAKFQSRSIPIQHWSKYLMTPKELSLLFAKFEESKSVLQQIASNDLGESGDIARKQLGIQ
Ga0315899_1023754823300031784FreshwaterQEQLFAKFKSRSIPIQQWSKYLMTPKELALLFQKLEKSNSVLQDIAKTDLGKSGELARKQLGIE
Ga0315900_1004981723300031787FreshwaterMLHPETYIAAQEQLFRKFQDRSIPIRHWSKYLMTPKELALLFKKLDQSNSVLREIAITDMGRSGELARKQLGI
Ga0315290_1118080613300031834SedimentAQEQLFAKFQSRTIPIQHWSKYLMTPKELSLLFAKFEESKSVLQQIASNDLGESGDIARKQLGIQ
Ga0315909_1011511443300031857FreshwaterMRSPKHYIAAQEQLFAKFKSRSIPIQQWSKYLMTPKELALLFQKLEKSNSVLQEIAKTDLGKSGELARKQLGIE
Ga0315297_1101610413300031873SedimentLLNRSPKLYITAQEQLFAKFKSRSIAIQHWSKHLMTPKELALLFRTIEKSKLALQKIAESDLGESGDIARKQLGIE
Ga0315285_1020761123300031885SedimentLNKHPKLYIAAQEQLFAKFQSRSIAIQHWSKYLMTPKELSLLFAKFEESKSVLQQIASNDLGESGDIARKQLGIQ
Ga0315283_1022648123300032164SedimentEQLFAKFKSRSIAIQHWSKHLMTPKELALLFRTIEKSKLALQKIAESDLGESGDIARKQLGIE
Ga0315268_1172871723300032173SedimentLNKHPKLYIAAQEQLFAKFQSRSIPIQHWSKYLMTPKELSLLFAKFEESKSVLQQIASNDLGESGDIARKQLGIE
Ga0334722_1039072513300033233SedimentSPKLYITAQEQLFAKFKSRSIAIQHWSKHLMTPKELALLFRTIEKSKLALQKIAESDLGESGDIARKQLGIE
Ga0316616_10025212823300033521SoilMRSPDHYIAAQEQLFAKFQSRSIAIQHWSKYLMTPKELALLFRKLEEHKSVIRQIATTDIGKSGDIARKHLGI
Ga0334980_0228664_3_1943300033816FreshwaterEQLFAKFQSRSIAIQHWSKYLMTPKELALLFQKLEKSNSVLREIAKTDLGQSGELARKQLGIE
Ga0334980_0258935_2_2203300033816FreshwaterSPNLYIAAQEQLFAKFQSRSIAIQHWSKYLMTPKELALLFQKLEKSNSVLREIAKTDLGQSGELARKQLGIE
Ga0334977_0209689_454_6783300033978FreshwaterMRSPKHYIAAQEQLFAKFKSRSIPIQQWSKYLMTPKELALLFQKLEKSNSVLQQIATTDLGKSGELARKQLGIE
Ga0334994_0059557_2148_23513300033993FreshwaterIAAQEQLFAKFQSRSIAIQHWSKYLMTPKELALLFQKLEKSNSVLREIAKTDLGQSGELARKQLGIE
Ga0334994_0082167_421_6453300033993FreshwaterMRSPKLYIAAQEQLFAKFQSRSIAIQHWSKYLMTPKELALLFSKLEKSNSVLSEIATTDLGRSGEIARKQLGIE
Ga0334994_0087607_1633_18513300033993FreshwaterHPKLYIAAQEQLFAKFQSRSIPIQHWSKYLMTPKELSLLFAKFEESKSVLQQIASNDLGESGDIARKQLGIQ
Ga0334994_0233742_769_9723300033993FreshwaterIAAQEQLFAKFQSRSIAIQHWSKYLMTPKELALLFQKLEKSNCVLREIAKTDLGQSGELARKQLGIE
Ga0334986_0133960_1172_13963300034012FreshwaterMRSPKHYIAAQEQLFAKFKSRSIPIQQWSKYLMTPKELALLFQKLEKSNSVLQEIATTDLGKSGELARKQLGIE
Ga0334987_0013881_7197_73943300034061FreshwaterAQEQLFAKFQSRSIAIQHWSKYLMTPKELALLFQKLEKSNSVLREIAKTDLGQSGELARKQLGIE
Ga0335010_0081669_2003_22033300034092FreshwaterAAQEQLFAKFQSRSIPIQHWSKYLMTPKELSLLFAKFEESKSVLQQIASNDLGESGDIARKQLGIQ
Ga0335027_0012247_7052_72763300034101FreshwaterMRNPNLYIAAQEQLFAKFQSRSIAIQHWSKYLMTPKELALLFQKLEKSNSVLREIAKTDLGQSGELARKQLGIE
Ga0335036_0398183_3_2063300034106FreshwaterIAAQEQLFAKFQSRSIAIQHWSKYLMTPKELALLFSKLEKSNSVLSEIAKTDLGRSGEIARKQLGIE
Ga0335053_0124231_1183_14103300034118FreshwaterMNKHPKLYIAAQEQLFAKFQSRSIPIQHWSKYLMTPKELSLLFAKFEESKSVLQQIASNDLGESGDIARKQLGIQ
Ga0335065_0001622_12098_123223300034200FreshwaterMRSPSHYIAAQEQLFTKFKSRSIPIQQWSKYLMTPKELALLFQKLEKSNSVLQDIAKTDLGRSGELARKQLGIE
Ga0335007_0586004_9_2333300034283FreshwaterMRSPNLYIAAQEQLFAKFQSRSIAIQHWSKYLMTPKELALLFQKLEKSNSVLREIAKTDLGKSGELARKQLGIE
Ga0335048_0095172_1616_18013300034356FreshwaterMRSPKLYIAAQEQLFAKFQSRSIAIQHWSKYLMTPKELALLFSKLEKSNSVLSEIAKTDLGR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.