Scaffold Ga0213849_1152562

Overview

Basic Information

• Taxon OID: 3300021857
• Scaffold ID: Ga0213849_1152562
• Source Dataset Name: Metatranscriptome of freshwater microbial communities from pre-fracked creek in Pennsylvania, United States - WE:C (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 587
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds → Freshwater And Sediment Microbial Communities From Various Areas In North America, Analyzing Microbe Dynamics In Response To Fracking

Source Dataset Sampling Location

• Location Name: USA: Pennsylvania
• Coordinates
  • Lat. (^o): 41.6118
  • Long. (^o): -78.4221

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013050	Metagenome / Metatranscriptome	275	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0213849_11525621	F013050	AGG	MSKGKQPRTRVKVPKLLLSEIKDVFFKNNQEIGLEAAIFXRPRNR