Scaffold Ga0226835_1000660

Overview

Basic Information

• Taxon OID: 3300021604
• Scaffold ID: Ga0226835_1000660
• Source Dataset Name: Anaerobic ammonium oxidizing microbial communities from anammox membrane bioreactor (MBR) in UC Berkley, California, United States - LAC_MetaG_1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 30858
• Total Scaffold Genes: 37
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 23 (62.16%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Bioreactor Biomass → Anaerobic Ammonium Oxidizing Microbial Communities From Anammox Membrane Bioreactor (Mbr) In Uc Berkley, California, United States

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 37.8719
  • Long. (^o): -122.2585

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024166	Metagenome / Metatranscriptome	207	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0226835_100066033	F024166	GGA	MVPGTRVEVRSRFERAWARGFEIAEEVGGPDGDDVRYRIRRRSDGSVLPALFTVDDVREEKRDRLWWI