| Basic Information | |
|---|---|
| Taxon OID | 3300021603 Open in IMG/M |
| Scaffold ID | Ga0226659_10137314 Open in IMG/M |
| Source Dataset Name | Granular sludge microbial community from anaerobic digester, University of Toronto, Ontario, Canada - UASBVu03_granules spades |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Toronto |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1206 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (80.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Granular Sludge → Metagenomes From Anaerobic Digester Of Solid Waste |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | University of Toronto, Toronto, Ontario, Canada | |||||||
| Coordinates | Lat. (o) | 43.6629 | Long. (o) | -79.3957 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F084191 | Metagenome / Metatranscriptome | 112 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0226659_101373144 | F084191 | AGGA | MSTHHRRKKLYPPDEQKKRDDYFREAGLLTSDERRIRQKRNFELWCEGRDNEIDTVQSL |
| ⦗Top⦘ |