NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0226655_10190822

Scaffold Ga0226655_10190822


Overview

Basic Information
Taxon OID3300021561 Open in IMG/M
Scaffold IDGa0226655_10190822 Open in IMG/M
Source Dataset NameAnaerobic digester digestate microbial community, University of Toronto, Ontario, Canada - DG074 spades
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Toronto
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)822
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division CPR1 → candidate division CPR1 bacterium ADurb.Bin160(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester Digestate → Metagenomes From Anaerobic Digester Of Solid Waste

Source Dataset Sampling Location
Location NameUniversity of Toronto, Toronto, Ontario, Canada
CoordinatesLat. (o)43.5479Long. (o)-79.6609Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F071210Metagenome / Metatranscriptome122N

Sequences

Protein IDFamilyRBSSequence
Ga0226655_101908221F071210AGGAGGMKEKRWLGTQKYEIHCFYCGGFHITGNCPQIVKAMKGWKYDRSCPETGHIKIVPNGDEYPTVLAFNGYHYRVVGLWGIPGRLLWLELERFCGDTIVAATFCPDELMEMDLGMSDDEQLSAWLGGLPFLSVSPSEFNRSEAEVDVKKT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.