Scaffold Ga0226655_10111368

Overview

Basic Information

• Taxon OID: 3300021561
• Scaffold ID: Ga0226655_10111368
• Source Dataset Name: Anaerobic digester digestate microbial community, University of Toronto, Ontario, Canada - DG074 spades
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Toronto
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1184
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → unclassified Methanoregulaceae → Methanoregulaceae archaeon PtaU1.Bin066 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester Digestate → Metagenomes From Anaerobic Digester Of Solid Waste

Source Dataset Sampling Location

• Location Name: University of Toronto, Toronto, Ontario, Canada
• Coordinates
  • Lat. (^o): 43.5479
  • Long. (^o): -79.6609

Associated Families

Family	Category	Number of Sequences	3D Structure?
F085739	Metagenome / Metatranscriptome	111	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0226655_101113682	F085739	GAGG	MREIPIAGETCCANCVHDATCSHRSALPGIALICDHFVNRTFPPEVQDAIQAGACCHICGAPAIIGGGGRVTCGNCLLAQAAAKAKIGDKIIKEWRGTVTTPPAPMFEAGADPDEVEEKEGV