Scaffold Ga0224710_1214528

Overview

Basic Information

• Taxon OID: 3300021557
• Scaffold ID: Ga0224710_1214528
• Source Dataset Name: Marine sponge C. singaporensis microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'control', co14ic 200bp no Eukaryotes last
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of New South Wales
• Sequencing Status: Finished

Scaffold Components

• Scaffold Length (bps): 685
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → C. Singaporensis (Marine Sponge) → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps

Source Dataset Sampling Location

• Location Name: Upa-Upasina 'control' site, Papua New Guinea
• Coordinates
  • Lat. (^o): -9.828217
  • Long. (^o): 150.820517

Associated Families

Family	Category	Number of Sequences	3D Structure?
F064809	Metagenome	128	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0224710_12145282	F064809	GGAG	MLTTTFTGNITFAEIVSQDGQGNNLDNPFLAIKVAVNDVNDNGLTIAVRTKNGLLEAAQNGEDLVGTRVVIAGSIELPSIRSHWVDNDGNLVALKKPQCRVYANTIERLNRKPAPDTVQKELAIK