Scaffold Ga0224705_1028745

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0224705_1028745

Scaffold Ga0224705_1028745

Overview

Basic Information
Taxon OID	3300021549 Open in IMG/M
Scaffold ID	Ga0224705_1028745 Open in IMG/M
Source Dataset Name	Marine sponge C. singaporensis associated microbial community from CO2 seep in Upa-Upasina, Papua New Guinea - co35is 200bp no Eukaryotes last
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of New South Wales
Sequencing Status	Finished

Scaffold Components
Scaffold Length (bps)	542
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Coelocarteria Singaporensis → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps

Source Dataset Sampling Location
Location Name	Upa-Upasina 'bubble' site, Papua New Guinea
Coordinates	Lat. (^o)	-9.8241	Long. (^o)	150.825833	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F101313	Metagenome / Metatranscriptome	102	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0224705_10287451	F101313	N/A	MTSALKREFKVGDEVCHTNKFSTGNNFQRKRKGVVLGIERRPVKDGKLRTYIEVLWNTSSVPCFHASHALLHLSEREGKQEEAFHVTHVTELHNFNEHGL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.