Scaffold Ga0224706_1006710

Overview

Basic Information

• Taxon OID: 3300021545
• Scaffold ID: Ga0224706_1006710
• Source Dataset Name: Marine sponge C. singaporensis associated microbial community from CO2 seep in Upa-Upasina, Papua New Guinea - co46is 200bp no Eukaryotes last
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of New South Wales
• Sequencing Status: Finished

Scaffold Components

• Scaffold Length (bps): 1330
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Coelocarteria Singaporensis (Marine Sponge) → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps

Source Dataset Sampling Location

• Location Name: Upa-Upasina 'bubble' site, Papua New Guinea
• Coordinates
  • Lat. (^o): -9.8241
  • Long. (^o): 150.825833

Associated Families

Family	Category	Number of Sequences	3D Structure?
F047732	Metagenome	149	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0224706_10067101	F047732	GGAGG	MQRGYAICTTDLSRILTIAPCKTKFIFVPITSGQVLTDAICFTDISNAKTIESRARKKFEGMPETRIVNVALLYN