NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0224707_164104

Scaffold Ga0224707_164104


Overview

Basic Information
Taxon OID3300021544 Open in IMG/M
Scaffold IDGa0224707_164104 Open in IMG/M
Source Dataset NameMarine sponge C. singaporensis associated microbial community from CO2 seep in Upa-Upasina, Papua New Guinea - co52is 200bp no Eukaryotes last
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of New South Wales
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)672
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Coelocarteria Singaporensis (Marine Sponge) → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps

Source Dataset Sampling Location
Location NameUpa-Upasina ?bubble? site, Papua New Guinea
CoordinatesLat. (o)-9.8241Long. (o)150.825833Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F085224Metagenome111N

Sequences

Protein IDFamilyRBSSequence
Ga0224707_1641041F085224N/AIKHPRPYLNYYRVRIRAALNGFSYQDLLRFKAIVMFPYSAFSGIMLELLEMGVPMFYPSKRLLKRWDESYGMMFQRTSGYGRRSAGGFSNIAYGKDLMPDPNDSVNREALHYWLDKSEFYNWDVRYFDSPADLHEQLKAADFEAMHRDVLKTRARMDKIRDKRWAEIKRDLTKTA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.