NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0224722_1054594

Scaffold Ga0224722_1054594


Overview

Basic Information
Taxon OID3300021518 Open in IMG/M
Scaffold IDGa0224722_1054594 Open in IMG/M
Source Dataset NameFreshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Balambano_FR1_MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyRestricted
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).


Scaffold Components
Scaffold Length (bps)1388
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment → Freshwater Sediment Microbial Communities From Lake Towuti, South Sulawesi, Indonesia

Source Dataset Sampling Location
Location NameIndonesia: South Sulawesi
CoordinatesLat. (o)-2.651Long. (o)121.2318Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F025574Metagenome / Metatranscriptome201Y

Sequences

Protein IDFamilyRBSSequence
Ga0224722_10545943F025574GGCGGMSGVDQPAPESQLGERNLTTLHAVAQALAIGPMFSVALILGGISRPDIGAGWNAALAVLIATFGVLAIGYVVAMYARRFSGAGAVYEYLTHGAHPWLGVLTAGFFFVGVLFLG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.