Scaffold Ga0213919_1007280

Overview

Basic Information

• Taxon OID: 3300021440
• Scaffold ID: Ga0213919_1007280
• Source Dataset Name: Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 3-17 MG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2860
• Total Scaffold Genes: 9
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 7 (77.78%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater → Freshwater Microbial Communities From Mcnutts Creek, Athens, Georgia, United States

Source Dataset Sampling Location

• Location Name: USA: Georgia
• Coordinates
  • Lat. (^o): 33.9301
  • Long. (^o): -83.5517
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F073235	Metagenome / Metatranscriptome	120	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0213919_10072809	F073235	GGAGG	MCQFKSAIVVRDEASKGGFRLLMSPWTESHSELITIHKLRDNDRLTFARVEFSPSSMDNAYLVEEYKIRLDEERKPDWWTAEIEADVTERMRAYIKSIIVDGDVELLIGGQFVIAPNAKVHCAHSMVINAICGGTVSAICGGTVSEIRGGTVSAIRGGTVSAICGGT