Scaffold Ga0213917_1000190

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0213917_1000190

Scaffold Ga0213917_1000190

Overview

Basic Information
Taxon OID	3300021437 Open in IMG/M
Scaffold ID	Ga0213917_1000190 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 1-17 MG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	11951
Total Scaffold Genes	19 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	16 (84.21%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater → Freshwater Microbial Communities From Mcnutts Creek, Athens, Georgia, United States

Source Dataset Sampling Location
Location Name	USA: Georgia
Coordinates	Lat. (^o)	33.9406	Long. (^o)	-83.5607	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019483	Metagenome / Metatranscriptome	229	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0213917_100019016	F019483	N/A	MANGTGTATVDFGAFPGKNETSVTVTGQTTISATSKAESWIMGDDTSTGHTAADHKYAPLFMALTCGTPTAATGFTIYARAIDKLQGTWTVRWVWSD

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.