NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0213868_10165099

Scaffold Ga0213868_10165099


Overview

Basic Information
Taxon OID3300021389 Open in IMG/M
Scaffold IDGa0213868_10165099 Open in IMG/M
Source Dataset NameCoastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1357
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Coastal Seawater Microbial Communities From Pivers Island, North Carolina, United States

Source Dataset Sampling Location
Location NameUSA: North Carolina
CoordinatesLat. (o)34.7181Long. (o)-76.6707Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F065486Metagenome / Metatranscriptome127N
F069778Metagenome / Metatranscriptome123N
F078233Metagenome / Metatranscriptome116N

Sequences

Protein IDFamilyRBSSequence
Ga0213868_101650991F069778N/AMKKIYIPCQEAKRILGYKNHNSIKYLVQQNQLNEYMIGPLKRKLYSLQEVRALQEIKKGPNNSVNP
Ga0213868_101650994F065486GAGMKDDLSDFRMLRDENLLDRYVSLTKAATILGYASYVSVNALIQNNKIRPYWLPGNSKKKILLSDLHKLLEEARSRPAPKKRGKGRPSII
Ga0213868_101650995F078233AGCAGMKENSKEKEFITFTKAARLLGYTSSQIINRLIDEKHLKAYSFPDSSTRKVCRHEVLSLIQLSVSKDSVDSE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.