Scaffold Ga0213875_10014107

Overview

Basic Information

• Taxon OID: 3300021388
• Scaffold ID: Ga0213875_10014107
• Source Dataset Name: Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3906
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (83.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots → Plant-Associated Microbial Communities From Velloziaceae Species In Rupestrian Grasslands, The National Park Of Serra Do Cipo, Brazil

Source Dataset Sampling Location

• Location Name: Brazil: Minas Gerais
• Coordinates
  • Lat. (^o): -19.2822
  • Long. (^o): -43.5936

Associated Families

Family	Category	Number of Sequences	3D Structure?
F105560	Metagenome / Metatranscriptome	100	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0213875_100141072	F105560	GGGGG	MFSRNIDFFAVLLIALAVLGLAEARSWNSAEALDSFQVENAIHIERCPIPEQILSTFSWFLHR