Scaffold Ga0213882_10059398

Overview

Basic Information

• Taxon OID: 3300021362
• Scaffold ID: Ga0213882_10059398
• Source Dataset Name: Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1519
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock → Plant-Associated Microbial Communities From Velloziaceae Species In Rupestrian Grasslands, The National Park Of Serra Do Cipo, Brazil

Source Dataset Sampling Location

• Location Name: Brazil: Minas Gerais
• Coordinates
  • Lat. (^o): -19.28
  • Long. (^o): -43.5919

Associated Families

Family	Category	Number of Sequences	3D Structure?
F041718	Metagenome / Metatranscriptome	159	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0213882_100593981	F041718	AGG	VANLVWRVRLVAELEPGVVSETEVARIVRDEQASLAKL