NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F041718

Metagenome / Metatranscriptome Family F041718

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F041718
Family Type Metagenome / Metatranscriptome
Number of Sequences 159
Average Sequence Length 43 residues
Representative Sequence VPKLVWRVKLVAELRPGVMTETEVARIERDEQAGLAELGLR
Number of Associated Samples 113
Number of Associated Scaffolds 159

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 84.91 %
% of genes near scaffold ends (potentially truncated) 89.31 %
% of genes from short scaffolds (< 2000 bps) 89.94 %
Associated GOLD sequencing projects 109
AlphaFold2 3D model prediction Yes
3D model pTM-score0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (67.925 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock
(16.352 % of family members)
Environment Ontology (ENVO) Unclassified
(18.868 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(35.849 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 10.14%    β-sheet: 37.68%    Coil/Unstructured: 52.17%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.48
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 159 Family Scaffolds
PF01609DDE_Tnp_1 2.52
PF13408Zn_ribbon_recom 1.89
PF02371Transposase_20 1.89
PF04199Cyclase 1.26
PF01575MaoC_dehydratas 1.26
PF13586DDE_Tnp_1_2 1.26
PF13701DDE_Tnp_1_4 1.26
PF00665rve 1.26
PF13751DDE_Tnp_1_6 1.26
PF13358DDE_3 1.26
PF01548DEDD_Tnp_IS110 1.26
PF00216Bac_DNA_binding 1.26
PF10335DUF294_C 0.63
PF00529CusB_dom_1 0.63
PF01610DDE_Tnp_ISL3 0.63
PF12762DDE_Tnp_IS1595 0.63
PF00574CLP_protease 0.63
PF02534T4SS-DNA_transf 0.63
PF00593TonB_dep_Rec 0.63
PF06745ATPase 0.63
PF13384HTH_23 0.63
PF07969Amidohydro_3 0.63
PF13495Phage_int_SAM_4 0.63
PF13551HTH_29 0.63
PF12760Zn_Tnp_IS1595 0.63
PF13340DUF4096 0.63
PF08240ADH_N 0.63
PF07508Recombinase 0.63
PF08734GYD 0.63
PF05973Gp49 0.63
PF13188PAS_8 0.63
PF00171Aldedh 0.63
PF03466LysR_substrate 0.63
PF13737DDE_Tnp_1_5 0.63
PF05853BKACE 0.63
PF02515CoA_transf_3 0.63
PF00118Cpn60_TCP1 0.63
PF03401TctC 0.63
PF13609Porin_4 0.63
PF13362Toprim_3 0.63
PF06202GDE_C 0.63
PF00078RVT_1 0.63
PF08281Sigma70_r4_2 0.63
PF00108Thiolase_N 0.63
PF13610DDE_Tnp_IS240 0.63
PF00903Glyoxalase 0.63
PF03626COX4_pro 0.63
PF01656CbiA 0.63
PF00528BPD_transp_1 0.63
PF13155Toprim_2 0.63
PF13333rve_2 0.63
PF03640Lipoprotein_15 0.63
PF05992SbmA_BacA 0.63
PF00872Transposase_mut 0.63
PF01471PG_binding_1 0.63
PF00589Phage_integrase 0.63
PF05974DUF892 0.63
PF14106DUF4279 0.63
PF13591MerR_2 0.63
PF01408GFO_IDH_MocA 0.63

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 159 Family Scaffolds
COG3547TransposaseMobilome: prophages, transposons [X] 3.14
COG3293TransposaseMobilome: prophages, transposons [X] 2.52
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 2.52
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 2.52
COG5421TransposaseMobilome: prophages, transposons [X] 2.52
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 2.52
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 2.52
COG4584TransposaseMobilome: prophages, transposons [X] 1.26
COG0740ATP-dependent protease ClpP, protease subunitPosttranslational modification, protein turnover, chaperones [O] 1.26
COG0776Bacterial nucleoid DNA-binding protein IHF-alphaReplication, recombination and repair [L] 1.26
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 1.26
COG0616Periplasmic serine protease, ClpP classPosttranslational modification, protein turnover, chaperones [O] 1.26
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 1.26
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 1.26
COG1878Kynurenine formamidaseAmino acid transport and metabolism [E] 1.26
COG4679Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin systemDefense mechanisms [V] 0.63
COG3408Glycogen debranching enzyme (alpha-1,6-glucosidase)Carbohydrate transport and metabolism [G] 0.63
COG4315Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown)Function unknown [S] 0.63
COG4274Uncharacterized conserved protein, contains GYD domainFunction unknown [S] 0.63
COG0459Chaperonin GroEL (HSP60 family)Posttranslational modification, protein turnover, chaperones [O] 0.63
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.63
COG3685Ferritin-like metal-binding protein YciEInorganic ion transport and metabolism [P] 0.63
COG3657Putative component of the toxin-antitoxin plasmid stabilization moduleDefense mechanisms [V] 0.63
COG0183Acetyl-CoA acetyltransferaseLipid transport and metabolism [I] 0.63
COG3505Type IV secretory pathway, VirD4 component, TraG/TraD family ATPaseIntracellular trafficking, secretion, and vesicular transport [U] 0.63
COG3464TransposaseMobilome: prophages, transposons [X] 0.63
COG1030Membrane-bound serine protease NfeD, ClpP classPosttranslational modification, protein turnover, chaperones [O] 0.63
COG3328Transposase (or an inactivated derivative)Mobilome: prophages, transposons [X] 0.63
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.63
COG3246Uncharacterized conserved protein, DUF849 familyFunction unknown [S] 0.63
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 0.63
COG3125Heme/copper-type cytochrome/quinol oxidase, subunit 4Energy production and conversion [C] 0.63
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.63
COG1961Site-specific DNA recombinase SpoIVCA/DNA invertase PinEReplication, recombination and repair [L] 0.63
COG1804Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferasesLipid transport and metabolism [I] 0.63


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms67.92 %
UnclassifiedrootN/A32.08 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2209111000|2209888357Not Available515Open in IMG/M
3300001686|C688J18823_11093867All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300003219|JGI26341J46601_10209711All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales527Open in IMG/M
3300003368|JGI26340J50214_10093439All Organisms → cellular organisms → Bacteria777Open in IMG/M
3300004152|Ga0062386_100967143All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300005184|Ga0066671_10203524All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae1192Open in IMG/M
3300005366|Ga0070659_101729116Not Available560Open in IMG/M
3300005506|Ga0068912_11170667All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300005539|Ga0068853_101700247Not Available612Open in IMG/M
3300005602|Ga0070762_10781111All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → unclassified Acetobacteraceae → Acetobacteraceae bacterium645Open in IMG/M
3300005618|Ga0068864_102564712Not Available516Open in IMG/M
3300005718|Ga0068866_10505249All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales800Open in IMG/M
3300006642|Ga0075521_10067977Not Available1588Open in IMG/M
3300006642|Ga0075521_10503377Not Available594Open in IMG/M
3300006794|Ga0066658_10113121All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1310Open in IMG/M
3300006804|Ga0079221_11075982Not Available612Open in IMG/M
3300006806|Ga0079220_10033072All Organisms → cellular organisms → Bacteria2310Open in IMG/M
3300006806|Ga0079220_10716391Not Available739Open in IMG/M
3300006881|Ga0068865_101893239Not Available540Open in IMG/M
3300006893|Ga0073928_11048778All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales554Open in IMG/M
3300009098|Ga0105245_10679253All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1062Open in IMG/M
3300009174|Ga0105241_11303963All Organisms → cellular organisms → Bacteria692Open in IMG/M
3300009400|Ga0116854_1099259All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Dankookia → Dankookia rubra697Open in IMG/M
3300009701|Ga0116228_11181569All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S103505Open in IMG/M
3300009709|Ga0116227_10769438All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300009789|Ga0126307_10582305Not Available904Open in IMG/M
3300009789|Ga0126307_11518545Not Available543Open in IMG/M
3300009840|Ga0126313_10579794All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria903Open in IMG/M
3300009840|Ga0126313_11191027Not Available628Open in IMG/M
3300010036|Ga0126305_10903999All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas wenyumeiae603Open in IMG/M
3300010037|Ga0126304_10076495All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp.2081Open in IMG/M
3300010037|Ga0126304_11051859All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp.556Open in IMG/M
3300010037|Ga0126304_11224868Not Available515Open in IMG/M
3300010038|Ga0126315_10224197Not Available1140Open in IMG/M
3300010040|Ga0126308_10806967All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Paracraurococcus → Paracraurococcus ruber650Open in IMG/M
3300010041|Ga0126312_10381047All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1001Open in IMG/M
3300010041|Ga0126312_10433170All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga ossetica937Open in IMG/M
3300010042|Ga0126314_10268311All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1213Open in IMG/M
3300010044|Ga0126310_11435484Not Available564Open in IMG/M
3300010044|Ga0126310_11465542Not Available559Open in IMG/M
3300010044|Ga0126310_11628626Not Available534Open in IMG/M
3300010045|Ga0126311_10493153All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Chelatococcaceae → Chelatococcus → Chelatococcus reniformis957Open in IMG/M
3300010045|Ga0126311_10741043All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Agrobacterium → Agrobacterium rhizogenes788Open in IMG/M
3300010146|Ga0126320_1000403All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300010146|Ga0126320_1094572All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S103563Open in IMG/M
3300010166|Ga0126306_10290913All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1256Open in IMG/M
3300010341|Ga0074045_10061827All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2673Open in IMG/M
3300010373|Ga0134128_12156827All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Brucellaceae → Brucella/Ochrobactrum group → Brucella → Brucella pinnipedialis614Open in IMG/M
3300010375|Ga0105239_10804847All Organisms → cellular organisms → Bacteria1077Open in IMG/M
3300010403|Ga0134123_13294443All Organisms → cellular organisms → Bacteria → Proteobacteria521Open in IMG/M
3300011106|Ga0151489_1191645All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300011119|Ga0105246_10036648All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3287Open in IMG/M
3300012212|Ga0150985_100644815All Organisms → cellular organisms → Bacteria → Proteobacteria533Open in IMG/M
3300012212|Ga0150985_101419487All Organisms → cellular organisms → Bacteria1378Open in IMG/M
3300012212|Ga0150985_103492398Not Available751Open in IMG/M
3300012212|Ga0150985_108687777All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium871Open in IMG/M
3300012212|Ga0150985_111270296All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1334Open in IMG/M
3300012212|Ga0150985_113944519All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales745Open in IMG/M
3300012212|Ga0150985_114228141All Organisms → cellular organisms → Bacteria996Open in IMG/M
3300012212|Ga0150985_115826498Not Available720Open in IMG/M
3300012212|Ga0150985_119637641Not Available691Open in IMG/M
3300012212|Ga0150985_121165118All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → unclassified Belnapia → Belnapia sp. F-4-1840Open in IMG/M
3300012469|Ga0150984_103276316All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis879Open in IMG/M
3300012469|Ga0150984_111549901Not Available536Open in IMG/M
3300012469|Ga0150984_114850637Not Available603Open in IMG/M
3300012469|Ga0150984_119721105Not Available610Open in IMG/M
3300012469|Ga0150984_122596039All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium1234Open in IMG/M
3300013308|Ga0157375_10124501All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2691Open in IMG/M
3300014487|Ga0182000_10392279All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300014488|Ga0182001_10087971All Organisms → cellular organisms → Bacteria935Open in IMG/M
3300014488|Ga0182001_10178233All Organisms → cellular organisms → Bacteria → Proteobacteria755Open in IMG/M
3300014968|Ga0157379_10790286All Organisms → cellular organisms → Bacteria895Open in IMG/M
3300014969|Ga0157376_10738711All Organisms → cellular organisms → Bacteria992Open in IMG/M
3300015262|Ga0182007_10368739Not Available543Open in IMG/M
3300018037|Ga0187883_10327039All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria783Open in IMG/M
3300018046|Ga0187851_10351164All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodovastum → Rhodovastum atsumiense848Open in IMG/M
3300018431|Ga0066655_11341188All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis516Open in IMG/M
3300018468|Ga0066662_12828241All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria515Open in IMG/M
3300018469|Ga0190270_10494044Not Available1164Open in IMG/M
3300018920|Ga0190273_11832568Not Available554Open in IMG/M
3300018946|Ga0193599_1151641All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia mucosa746Open in IMG/M
3300019377|Ga0190264_10903205All Organisms → cellular organisms → Bacteria → Proteobacteria690Open in IMG/M
3300020021|Ga0193726_1199596All Organisms → cellular organisms → Bacteria842Open in IMG/M
3300021170|Ga0210400_10260625All Organisms → cellular organisms → Bacteria → Proteobacteria1419Open in IMG/M
3300021170|Ga0210400_10651841Not Available867Open in IMG/M
3300021362|Ga0213882_10059398All Organisms → cellular organisms → Bacteria1519Open in IMG/M
3300021374|Ga0213881_10064696All Organisms → cellular organisms → Bacteria1558Open in IMG/M
3300021377|Ga0213874_10046506All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium1317Open in IMG/M
3300021404|Ga0210389_11273597Not Available564Open in IMG/M
3300021404|Ga0210389_11526169Not Available507Open in IMG/M
3300021405|Ga0210387_10254872All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae1536Open in IMG/M
3300021405|Ga0210387_11025647Not Available722Open in IMG/M
3300021405|Ga0210387_11731842Not Available528Open in IMG/M
3300021441|Ga0213871_10133023Not Available748Open in IMG/M
3300025703|Ga0208357_1128508Not Available727Open in IMG/M
3300025878|Ga0209584_10038140Not Available1677Open in IMG/M
3300025878|Ga0209584_10326331Not Available591Open in IMG/M
3300025900|Ga0207710_10088699All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae1445Open in IMG/M
3300025901|Ga0207688_10213528All Organisms → cellular organisms → Bacteria1160Open in IMG/M
3300025901|Ga0207688_10362358All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria895Open in IMG/M
3300025916|Ga0207663_11705521All Organisms → cellular organisms → Bacteria → Proteobacteria507Open in IMG/M
3300025929|Ga0207664_10570014All Organisms → cellular organisms → Bacteria → Proteobacteria1016Open in IMG/M
3300025941|Ga0207711_10875761All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria835Open in IMG/M
3300025972|Ga0207668_12098493Not Available509Open in IMG/M
3300026035|Ga0207703_10148888Not Available2039Open in IMG/M
3300026041|Ga0207639_11542190All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300026067|Ga0207678_10743793Not Available864Open in IMG/M
3300026075|Ga0207708_11386829All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300026089|Ga0207648_10364770All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1304Open in IMG/M
3300026118|Ga0207675_102514114All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300027619|Ga0209330_1092337Not Available689Open in IMG/M
3300027750|Ga0209461_10146531All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300027812|Ga0209656_10342585All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300027903|Ga0209488_11155409Not Available524Open in IMG/M
3300028587|Ga0247828_10589703All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria676Open in IMG/M
3300028705|Ga0307276_10221072Not Available504Open in IMG/M
3300028798|Ga0302222_10044322All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S1031810Open in IMG/M
3300029999|Ga0311339_11450768Not Available614Open in IMG/M
3300030523|Ga0272436_1031256All Organisms → cellular organisms → Bacteria → Proteobacteria3205Open in IMG/M
3300030545|Ga0210271_10665149All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1010Open in IMG/M
3300031058|Ga0308189_10511131Not Available519Open in IMG/M
3300031091|Ga0308201_10327709All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300031231|Ga0170824_109143487All Organisms → cellular organisms → Bacteria → Proteobacteria812Open in IMG/M
3300031234|Ga0302325_10965216Not Available1171Open in IMG/M
3300031234|Ga0302325_13141437Not Available529Open in IMG/M
3300031449|Ga0272429_1076600All Organisms → cellular organisms → Bacteria → Proteobacteria2178Open in IMG/M
3300031449|Ga0272429_1237500Not Available670Open in IMG/M
3300031449|Ga0272429_1247033Not Available640Open in IMG/M
3300031451|Ga0272426_1177904All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300031453|Ga0272425_1033535All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3207Open in IMG/M
3300031453|Ga0272425_1184847All Organisms → cellular organisms → Bacteria843Open in IMG/M
3300031454|Ga0272427_1091496All Organisms → cellular organisms → Bacteria1158Open in IMG/M
3300031454|Ga0272427_1099770All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae1068Open in IMG/M
3300031454|Ga0272427_1135406All Organisms → cellular organisms → Bacteria803Open in IMG/M
3300031454|Ga0272427_1199446All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia → unclassified Caballeronia → Caballeronia sp. AZ10_KS36564Open in IMG/M
3300031460|Ga0272430_1066768All Organisms → cellular organisms → Bacteria → Proteobacteria2055Open in IMG/M
3300031470|Ga0272432_1063519All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae2063Open in IMG/M
3300031470|Ga0272432_1064012Not Available2049Open in IMG/M
3300031470|Ga0272432_1090839All Organisms → cellular organisms → Bacteria1545Open in IMG/M
3300031472|Ga0272437_1058307All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales3104Open in IMG/M
3300031472|Ga0272437_1149583All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → Azospirillum lipoferum1379Open in IMG/M
3300031474|Ga0170818_106857655All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → Sphingobium indicum → Sphingobium indicum BiD32788Open in IMG/M
3300031520|Ga0272428_1035702All Organisms → cellular organisms → Bacteria → Proteobacteria4406Open in IMG/M
3300031520|Ga0272428_1176765All Organisms → cellular organisms → Bacteria1100Open in IMG/M
3300031520|Ga0272428_1211108All Organisms → cellular organisms → Bacteria938Open in IMG/M
3300031520|Ga0272428_1404599All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium510Open in IMG/M
3300031902|Ga0302322_102464810All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S103641Open in IMG/M
3300031938|Ga0308175_103192000All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales508Open in IMG/M
3300032126|Ga0307415_101556390All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300032162|Ga0272424_1271267All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300033168|Ga0272423_1020070All Organisms → cellular organisms → Bacteria5262Open in IMG/M
3300033168|Ga0272423_1060203All Organisms → cellular organisms → Bacteria2501Open in IMG/M
3300033181|Ga0272431_10208090All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium plurifarium1106Open in IMG/M
3300033181|Ga0272431_10371622Not Available656Open in IMG/M
3300033887|Ga0334790_057314All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1418Open in IMG/M
3300034000|Ga0334918_064204All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300034007|Ga0334936_112846Not Available568Open in IMG/M
3300034358|Ga0370485_0193695Not Available635Open in IMG/M
3300034377|Ga0334931_143605All Organisms → cellular organisms → Bacteria572Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
RockEnvironmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock16.35%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil11.95%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere6.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.03%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil3.14%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere3.14%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.52%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.52%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.89%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil1.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.89%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.26%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil1.26%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.26%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.26%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.26%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.26%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock1.26%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.26%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.26%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.26%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.26%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.26%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.26%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.26%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.26%
Host-AssociatedHost-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated1.26%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.63%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.63%
Sub-Biocrust SoilEnvironmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil0.63%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.63%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.63%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.63%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.63%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.63%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.63%
BiocrustEnvironmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust0.63%
Hypolithic BiocrustEnvironmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust0.63%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.63%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.63%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.63%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.63%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.63%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.63%
AgaveHost-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave0.63%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2209111000Soil microbial communities from Colorado Plateau, Greene Butte sample - Dark Crust, Colorado Plateau, Green ButteEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300003219Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3EnvironmentalOpen in IMG/M
3300003368Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005506Soil microbial communities from Colorado Plateau, USA - Soil Crust after dry out 3A (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300006642Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-DEnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009400Soil microbial community of the Robinson Ridge, Antarctica. Combined Assembly of Gp0139162, Gp0138857, Gp0138858EnvironmentalOpen in IMG/M
3300009701Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum fallax MGHost-AssociatedOpen in IMG/M
3300009709Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010146Soil microbial communities from California, USA to study soil gas exchange rates - JR-CA-SND metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011106Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014487Bulk soil microbial communities from Mexico - Magueyal (Ma) metaGEnvironmentalOpen in IMG/M
3300014488Bulk soil microbial communities from Mexico - San Felipe (SF) metaGEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015262Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaGHost-AssociatedOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300018946Soil crust microbial communities from Colorado Plateau, Utah, USA - mid-late stage, 0 min after wetting v1EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300020021Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1EnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021362Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09EnvironmentalOpen in IMG/M
3300021374Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08EnvironmentalOpen in IMG/M
3300021377Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7Host-AssociatedOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021441Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1Host-AssociatedOpen in IMG/M
3300025703Arctic peat soil from Barrow, Alaska - NGEE Surface sample F52-2 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025878Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes)EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027619Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027750Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028705Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115EnvironmentalOpen in IMG/M
3300028798Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2EnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030523Rock endolithic microbial communities from Victoria Land, Antarctica - Richard Nunatak white sandstoneEnvironmentalOpen in IMG/M
3300030545Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO142-VCO033SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031058Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031091Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031449Rock endolithic microbial communities from Victoria Land, Antarctica - Finger Mt sudEnvironmentalOpen in IMG/M
3300031451Rock endolithic microbial communities from Victoria Land, Antarctica - Siegfried Peak nordEnvironmentalOpen in IMG/M
3300031453Rock endolithic microbial communities from Victoria Land, Antarctica - Pudding Butte sudEnvironmentalOpen in IMG/M
3300031454Rock endolithic microbial communities from Victoria Land, Antarctica - Siegfried Peak sudEnvironmentalOpen in IMG/M
3300031460Rock endolithic microbial communities from Victoria Land, Antarctica - Linnaeus Terrace nordEnvironmentalOpen in IMG/M
3300031470Rock endolithic microbial communities from Victoria Land, Antarctica - University Valley nordEnvironmentalOpen in IMG/M
3300031472Rock endolithic microbial communities from Victoria Land, Antarctica - Richard Nunatak red sandstoneEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031520Rock endolithic microbial communities from Victoria Land, Antarctica - Finger Mt nordEnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032162Rock endolithic microbial communities from Victoria Land, Antarctica - Pudding Butte nordEnvironmentalOpen in IMG/M
3300033168Rock endolithic microbial communities from Victoria Land, Antarctica - Mt New Zealand sudEnvironmentalOpen in IMG/M
3300033181Rock endolithic microbial communities from Victoria Land, Antarctica - Linnaeus Terrace sudEnvironmentalOpen in IMG/M
3300033887Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1EnvironmentalOpen in IMG/M
3300034000Biocrust microbial communities from Mojave Desert, California, United States - 14HMCEnvironmentalOpen in IMG/M
3300034007Biocrust microbial communities from Mojave Desert, California, United States - 32SMCEnvironmentalOpen in IMG/M
3300034358Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_16EnvironmentalOpen in IMG/M
3300034377Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 27HNSEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
22100236482209111000SoilVPKLVWRVKLVAELEPGVATETEVARIERGEEVGLADLGLRLEEAKLELWPKLGDG
C688J18823_1109386713300001686SoilVKLVAELRPGVMTETEVARIERDEQAGLADLGLRLAE
JGI26341J46601_1020971113300003219Bog Forest SoilMPKMVWRVKLVAELEPGSTTEVEVARLERDEQAGLANLGLR
JGI26340J50214_1009343923300003368Bog Forest SoilVPKLVWRVKLVAEPRPGVMTETEVARIERDEQAGLADLGLRL
Ga0062386_10096714313300004152Bog Forest SoilVAKLVWRVKLVTELRAGETTEVEVARIERDEQVDLSDLGL
Ga0066671_1020352413300005184SoilVPKLVWRVKLVAELRPGVTTETEVARIERGAEAGLADLGLRLDEAKQL
Ga0070659_10172911613300005366Corn RhizosphereVAKLVWRVKLVAELEPGVATETEVARFERDEVVGLADLGLRL
Ga0068912_1117066723300005506SoilVPKLVWRVRLVAELRPGVTTETEVASIERGEEINPAELGLRLDE
Ga0068853_10170024723300005539Corn RhizosphereVSKLVWRVKLVAELEPGVTTETEVARIERGEEAGLADLGLRL
Ga0070762_1078111113300005602SoilVAKLVWRVKLVSELPAGVTTEVEIAHLERDEQAGVAELGLRLAEAKQLT
Ga0068864_10256471213300005618Switchgrass RhizosphereVPKLVWRVKLVAELRPGVTTETEVARIERGAEAGLAELGLRLDEAKQLT
Ga0068866_1050524923300005718Miscanthus RhizosphereLVTELQTGETTEVEVARIERDEQAGLSDLGLRLAEAKQLT
Ga0075521_1006797713300006642Arctic Peat SoilVPKLAWRVKVVAEFESGETTEVEVAHLERDVQVGLADLG
Ga0075521_1050337713300006642Arctic Peat SoilMGSRDEGELVPKLVWRVKLVAELESGETTEVEVAHLERDVQVGLADLGL
Ga0066658_1011312113300006794SoilVPKLVWRVKLVAELRPGVMTETEVARIERDEQAGLAELG
Ga0079221_1107598213300006804Agricultural SoilVSRVELVAEPEPGVAIETELARIERDPQAGLADLGL
Ga0079220_1003307213300006806Agricultural SoilVPKLVWRVKLVAELQPGVMTETEVARIERDAGANLAEL
Ga0079220_1071639123300006806Agricultural SoilVTKLVWRLKVVAELRPGVVRETEVARIERDEQADLADLGLRLA
Ga0068865_10189323923300006881Miscanthus RhizosphereMWRVKVVAEVQSGVTAETEVARIERDEEANLAELGLRLD
Ga0073928_1104877813300006893Iron-Sulfur Acid SpringMVWRVKLVAAVQAGEPTEVELARFERDEQAGLAGLGLRLAEAKHG*
Ga0105245_1067925313300009098Miscanthus RhizosphereVPKLVWRVKLVAELQAGVTTETEVARIERGEEAGLADLGL
Ga0105241_1130396323300009174Corn RhizosphereVVKLRWRVKLVAEWPSGVITETELACIERDQQTGLADFGLSLAEA
Ga0116854_109925913300009400SoilVGKVVLRVKPVAELPAGEPTEVELACFERDEQVGLADLGLSLAEAKQLT
Ga0116228_1118156923300009701Host-AssociatedLVAKLVWRIKLVTELQAGETTEVEVARFERYEQVGLSDLGLRLAEAK
Ga0116227_1076943823300009709Host-AssociatedVPKLVWRVKLVAEFESGETTEVEVAHLERDVQVGLADLGLRLAEAK
Ga0126307_1058230523300009789Serpentine SoilVPKLVWRVKLVAELQAGVTTETEVACIERDEEALLADLGLRLAE
Ga0126307_1151854513300009789Serpentine SoilVPKLVWRVKLVAELRPGVTTETEVARIERGEAVGLAELGL
Ga0126313_1057979423300009840Serpentine SoilLVSKLVWRVKLVVKLVAELEPGVTTETEVACLERGEEAGLADL
Ga0126313_1119102723300009840Serpentine SoilVPKRVWRVKLVAELQPGVTTETEVARLERGEEAGLADLGL
Ga0126305_1090399923300010036Serpentine SoilVLKLVWRVKLVAEPRPGVMTATEVARIERGAEAGLA
Ga0126304_1007649513300010037Serpentine SoilVPKLVWRVKLVVELHAGATTETEVARIERGEEAGLADLGLRLDDVNGP*
Ga0126304_1105185913300010037Serpentine SoilVPKLVWRVKLVAELRPGVMTETEVARIERDEQAGLAELGL
Ga0126304_1122486813300010037Serpentine SoilVPKLVWRVKLVAELEPGVATETEVGRFERGEEVGLAD
Ga0126315_1022419713300010038Serpentine SoilVAKLVWRVKLVAELQAGVTTETEVARIERGEEAGLADLGL
Ga0126308_1080696723300010040Serpentine SoilVAKLVWRVKLVAELQPGVTTETEVARIGRDADANLAELGLRLE
Ga0126312_1038104713300010041Serpentine SoilVPKLVWRVRLVAELRPGVATETEVACIERGGEINPAEL
Ga0126312_1043317023300010041Serpentine SoilVPKLVWRLKLVAELAPGVATETEVGRFERGEEVGLA
Ga0126314_1026831113300010042Serpentine SoilLVWRVKLVAELETGVATETEVARFERDEVAGLADLGLSARLERVTGLA*
Ga0126310_1143548413300010044Serpentine SoilVPKLVWRVKLVAELRPGVMTETEIARIERGAAVGVAELGLRLDEAKQLTA
Ga0126310_1146554213300010044Serpentine SoilVPKLVWRVKLVAELEPGVTTETEVACLERGEEAGL
Ga0126310_1162862623300010044Serpentine SoilVAKLVWRVKLVAELEPGVVTETELARIERDAQAGL
Ga0126311_1049315313300010045Serpentine SoilVPKLVWRVKLVAELQPGVMTETEVARMERSEAVGLAELGLRLDEAKQLTAA
Ga0126311_1074104323300010045Serpentine SoilVPKLVWRVKLVAELEPGVTTETEVACLERNEEAGLADLGLRLD
Ga0126320_100040323300010146SoilVPKLVWRVKLVAELRPGVTTETEGARIERSEAGGLAEL
Ga0126320_109457213300010146SoilVTKLVWRVKLVTELQAEEPTEVELTCFERDEQVGLADLGLSLAEAKQLTATQAG
Ga0126306_1029091313300010166Serpentine SoilVPKLVWRVKLVAELQTGVTTETEVARIERGEEAGLADLGLRLD
Ga0074045_1006182713300010341Bog Forest SoilMVWRVKLVAEQEFGFTTEVEVARLERDEQAGLADLGLR
Ga0134128_1215682723300010373Terrestrial SoilVPKLVWRVKLVAELQAGVTTETEVALIERGEEAGLADLGLRLDEAKQ
Ga0105239_1080484713300010375Corn RhizosphereVVKLRWRVKLVAEWPSGVITETELACIERDQQTGLADF
Ga0134123_1329444323300010403Terrestrial SoilVPKLVWRVKLVAELRPGVMTETEVARIERDEQTGLADLGLRLDEAK
Ga0151489_119164523300011106SoilVWRVKLVTELEAGETTEIEVARIERDEQASLGALVHMQD*
Ga0105246_1003664813300011119Miscanthus RhizosphereVAKLVWRVKLAAELEPGVATETEVARFERDEVVGLADLGLR
Ga0150985_10064481513300012212Avena Fatua RhizosphereVPKLVWRVKLVAELRPGVMTETEVARIERDEQAGLA
Ga0150985_10141948733300012212Avena Fatua RhizosphereVAKLVWRVKLVAELQAGVTTETEVARIKRGEEAGLADLGLRLNEAKQLTGA
Ga0150985_10349239833300012212Avena Fatua RhizosphereVPKLVWRVKLVAELQAGVTTETEVARIERGEEAGLAD
Ga0150985_10868777713300012212Avena Fatua RhizosphereVGVRGATPVPKLVWRVKLVTELEPGVATETEVARIERGEAAGLADLGLR
Ga0150985_11127029623300012212Avena Fatua RhizosphereVAKLVWRVKLVAELQAGVTTETEVARIERREEAGLADLGLRLDE
Ga0150985_11394451923300012212Avena Fatua RhizosphereMQGYVLGSRNESKLARKMVWRVKLVAELEPGSTTEVEVACLERDGRAGLADLGLRLAESLTRID*
Ga0150985_11422814123300012212Avena Fatua RhizosphereVAKLVWRVKLVAELEPGVATETEVARFERDEVVGLADLGLRLEEAKRRSG*
Ga0150985_11582649813300012212Avena Fatua RhizosphereVPKLVWRVKLVTELQPGVTTETEVACLERNDEADLA
Ga0150985_11963764113300012212Avena Fatua RhizosphereVSKLVWRVKLVAELQPGVTTETEVARIERDEQANLAELVPEFA
Ga0150985_12116511813300012212Avena Fatua RhizosphereVSKLVWRVKLVAELEPGMTTETEVAWIERGERPAWRTSGS
Ga0150984_10327631623300012469Avena Fatua RhizosphereVAKLVWRVKLVAELEPGVVTETELARIERDAQAGLAELGLQLDEAKRLT
Ga0150984_11154990113300012469Avena Fatua RhizosphereLGSRDEDERVAKLLWRVKLVAELQPGVTTETEVARIERDEQANLA
Ga0150984_11485063733300012469Avena Fatua RhizosphereVAKLVWRVKLVAELQPGVTTETEVARIERTEEAGLAELGLRLEEAKQL
Ga0150984_11972110513300012469Avena Fatua RhizosphereVLKLVWRVKLVAELQAGVTTETEVARIERGEEAGLA
Ga0150984_12259603923300012469Avena Fatua RhizosphereVPNLVWRVKLVAELEPGVATETEVARIERGEAIGLADLGL
Ga0157375_1012450143300013308Miscanthus RhizosphereVPKLVWRVKLVAELEPGVTSETEVARLERGEEAGL
Ga0182000_1039227913300014487SoilVAKLVWRVKLVAELRPGAETEVEVARIERGVEAGLADLGLRLDEAKESMQTSGG*
Ga0182001_1008797113300014488SoilVPKLVWRVKLVAELRPGVMTETEVARIERDEQAGLAELGLQLAEAK
Ga0182001_1017823323300014488SoilVPKLVWRVKLVAELQAGVTTETEVACIERGEEASLADLGLRLDEA
Ga0157379_1079028613300014968Switchgrass RhizosphereVPKLVWRVKLVAELRPGVTTEIEVARIERGEAVGLAELG
Ga0157376_1073871113300014969Miscanthus RhizosphereVWRVKLVAELQPGVTTETEVARIERDDEVRPAELG
Ga0182007_1036873923300015262RhizosphereVPKLVWRVKLVAELQAGVTTETEVTRIERSEEAGLADLGLRL
Ga0187883_1032703933300018037PeatlandMWRVNWVAEFESGETTEVEVARLERDEQAVRADFGLRL
Ga0187851_1035116413300018046PeatlandVPKLVWRVKLVAEFRAGATTEVEVARIERDEQAGLYDLGLHL
Ga0066655_1134118813300018431Grasslands SoilLSSRDEGGLVPKLVWRVKLVAELEPGLTTEVEVARRERDAQAGLADLGLRLAEAKRL
Ga0066662_1282824113300018468Grasslands SoilVPKLVWRIKLVPELRLGVVTGTEVARIDRDPQADLADLGL
Ga0190270_1049404433300018469SoilVAKLVWQVKLVAELEPGVATETEVARFERDEVAGLADLGL
Ga0190273_1183256823300018920SoilVPKLVWRVKLMAEPGPGVATETEVARIERGEEVGLAGL
Ga0193599_115164113300018946SoilGRRGPVPKLVWRVKLVAELEPGVATETEVARIERGEEVGLAELGLRL
Ga0190264_1090320533300019377SoilVAKLVWRVKLVAELEPGVATETEVARLERGEEAGLADLGLRLEEAKRLTA
Ga0193726_119959623300020021SoilVTKLVWRVKLVTELEAGETTEIEVARIERDEQATLADLGLRLS
Ga0210400_1026062513300021170SoilVPKPVWWVKLVTELRPGEVTETKVARVQRDEHAGIADLGLRLTET
Ga0210400_1065184113300021170SoilVPKLVWRRVKLVADLRPGEVTETEVARVERDEHAGI
Ga0213882_1005939813300021362Exposed RockVANLVWRVRLVAELEPGVVSETEVARIVRDEQASLAKL
Ga0213881_1006469623300021374Exposed RockVANLVWRVRLVAELEPGVVSETELARIVRDEQASLAELGL
Ga0213874_1004650613300021377Plant RootsVAKLVWRVKLVAERQPGVTTETELARIERPEQAALAELGLLDRLISTR
Ga0210389_1127359713300021404SoilVPNLVWRVKLVAELEPGLTTEVEVARLERDEQPGLADLGL
Ga0210389_1152616913300021404SoilVPKLVWRVKLEAELRPGEVTETEVARVERDEHAGIADLGLRLTETK
Ga0210387_1025487223300021405SoilVPNLVWRVKLVAELEPGLTTEVEVARLERDEQASLA
Ga0210387_1102564723300021405SoilVPKLVWRVTLVAELRPGEVTETEVARIERDEQADTADLGLRLTET
Ga0210387_1173184223300021405SoilAELVWRVKLVAELRPGEVTETEVARVERDEQAGIRCRRYR
Ga0213871_1013302323300021441RhizosphereVAKLVWRVKLVAETRPGVTTETEVARTERDEEAGLAG
Ga0208357_112850823300025703Arctic Peat SoilMGSRDEGERVPKLVWRVKLVAEFETGERSEVEVARLERDEQAGLADLGLRLAE
Ga0209584_1003814013300025878Arctic Peat SoilMGSRDEGELVPKLAWRVKVVAEFESGETTEVEVAHLERDVQVGLADLGPRLADRWLRVSAFP
Ga0209584_1032633113300025878Arctic Peat SoilMGSRDEGELVPKLVWRVKLVAELESGETTEVEVAHLERDVQVGLADLGLRLAEAKQLDDQADP
Ga0207710_1008869933300025900Switchgrass RhizosphereVPKLMWRVKLVAELRPGVMTETEVARIERDEQAGLAELGLQLAEA
Ga0207688_1021352813300025901Corn, Switchgrass And Miscanthus RhizosphereVSKLVWRVKLVAELEPGVTTETEVACLKRGEEAGLADL
Ga0207688_1036235813300025901Corn, Switchgrass And Miscanthus RhizosphereVPKLVWRVKLVAELQAGVTTETEVTRVERSEEAGL
Ga0207663_1170552123300025916Corn, Switchgrass And Miscanthus RhizosphereVAKLVWRVKLVAELQPGVATETEVARIERYEEAGLADLGL
Ga0207664_1057001413300025929Agricultural SoilVAKLVWRVKLVAELQPGVATETEVARIERDEEAGLAD
Ga0207711_1087576123300025941Switchgrass RhizosphereVPKLVWRVKLVAELQAGVTTETEVARIERGEEAGLAELGLRLDEAKQ
Ga0207668_1209849323300025972Switchgrass RhizosphereVAKLVWRVKLVAELQAGVTTETEVARIERGEEAGL
Ga0207703_1014888813300026035Switchgrass RhizosphereVPKLVWRVKLVAELQAGVTTETEVARIERGEEAGLAELGLRLDEAK
Ga0207639_1154219023300026041Corn RhizosphereLVWRVKLVAELEPGVATETEVVRFERDEVVGLADLGLRV
Ga0207678_1074379313300026067Corn RhizosphereVPKLVWRVKLVAELRPGVMTETEVARIERDEQAGLAELGLQLAEAKQL
Ga0207708_1138682923300026075Corn, Switchgrass And Miscanthus RhizosphereVPKLVWRVKLVAELQAGVTTETEVARIERGEEAGLAELGLRL
Ga0207648_1036477013300026089Miscanthus RhizosphereVPKLVWRVKLVAELQAGVTTETEVARIERGEEAGLA
Ga0207675_10251411413300026118Switchgrass RhizosphereVPKLVWRVKLVAELRPGVITETEVARIERDEQAGLAEL
Ga0209330_109233723300027619Forest SoilVGLVQLVWRVKLVAELRPGVMIESEVARIERDEHAGLA
Ga0209461_1014653113300027750AgaveMDLVPKLVWRVKLVAELRPGVMTETEVARIERDEQAGLADLGLQ
Ga0209656_1034258523300027812Bog Forest SoilMGYVWSSRDEGELMPKMVWRVKLVAEPEPGLTTEVEVARFERDEQAGLADLGLRLA
Ga0209488_1115540913300027903Vadose Zone SoilVPNLVWRVKLVAEFETGETTEVEVARLERDEQAGLADLG
Ga0247828_1058970323300028587SoilVPKLVWRVKLVAELEPGVATETEVARIERGEEVGLAELGLRLEEAKAKRCWTP
Ga0307276_1022107223300028705SoilVPKLVWRVKLVAELEPGVTTETEVACLERGEEAGLADLGLRLD
Ga0302222_1004432213300028798PalsaMGSRDEGKLVPKLVWRVKLVAEFETGETTEVEVARLERDEQAGLADLGLRLDEAADSRDT
Ga0311339_1145076813300029999PalsaMGSRDEGKLVPKLVWRVKLVAEFETGETTEVEVARLERDEQAVLADLGLR
Ga0272436_103125653300030523RockVAKLVWRVKLVTERQPGVTTETELACIERDEQAGLADLGLSL
Ga0210271_1066514943300030545SoilAKMVWRLKLVAELGAGSTAEVEVARFERDEQAGLADLGLRLAEAKQIEGMQTCGGASG
Ga0308189_1051113113300031058SoilVPKLVWRVKLVAELEPGVATETEVARIERDEEAGLADLGLRLEE
Ga0308201_1032770913300031091SoilVAKLLWRVKLVAELQPGMTTETEVARIERDEDANLAELGLR
Ga0170824_10914348723300031231Forest SoilMGSRDEGELVPKLVWRVRLVAEFETGETTEVEVARLERDEHAGLAGSVRARAKQV
Ga0302325_1096521623300031234PalsaMGSRDEGELVPKLVWRVKLVAEFETGETTEVEVARLERDEQAGLADLGLRLAEAKQMT
Ga0302325_1314143723300031234PalsaVVLVAKLVWRVKLVAQLRPGVSTETEVARIERDDRVGLA
Ga0272429_107660033300031449RockVLKLVWRVKLEAELPAGVTTEVEVARLERDEQAGLAELGLRLAEAKQ
Ga0272429_123750013300031449RockVPKLAWRVKLVAELRPGVTTETEVAQIEREEQAGVAELGCQVTG
Ga0272429_124703313300031449RockVAKLVWRVKLVTERQPGVTTETELACIERDEQAGLAD
Ga0272426_117790413300031451RockVPKLVWRVKLVAELRPGVTTETEVARIERDEQAGLAELGLRLAE
Ga0272425_103353543300031453RockVPKLVWRVKLVAELRPGVTTETEVACIERDEQAGLAELELPLV
Ga0272425_118484713300031453RockVAKLKWRVRLVTERHPGAVTETELACIERDEGIGVADLGLRLD
Ga0272427_109149613300031454RockVTKLMWRVMLVAELHPGMTTETELACIERDEEVGLA
Ga0272427_109977013300031454RockVAKLVWQVKLAAELEPGVVTETELARIERDEQAGL
Ga0272427_113540623300031454RockVPKLVWRVKLVAELEPGVATETEVARFERDEEAGLADLGLRLEETKRLTA
Ga0272427_119944623300031454RockVSKLLWRVKLAAERQPGVTTETELACIERDAQAGLADLGLSL
Ga0272430_106676813300031460RockVSKLLWRVKLVAERQPGVTTDIEFAGIERDAQAGLADLGVCK
Ga0272432_106351913300031470RockVPKLVWRVKLVAELRPGVMTETEVARIERDEQAGLAE
Ga0272432_106401223300031470RockMAKLVWRVKLVAELQAEVTTEAEVGRLERDEQAVRDR
Ga0272432_109083963300031470RockVPKLVWRVKLVAELRPGVMTETEVARIERDEQAGLAELGLR
Ga0272437_105830713300031472RockVPKLVWRVKLIAELRPGVMTEAEVARIERDELACLAELGLRLDETKQ
Ga0272437_114958313300031472RockVSKLLWRVKLVAERQPGVTTETELACIERDAQAGLAD
Ga0170818_10685765513300031474Forest SoilRDEGELVPKLVWRVRLVAEFETGETTEVEVARLERDEHAGLAGSVRARAKQV
Ga0272428_103570213300031520RockVAKLKWRVKLVAERHPGVTTKTELACIGRDEDVGLADLGLRLGE
Ga0272428_117676513300031520RockVAKLVWRVKLVAELRPGVTTETEVARIERDEQAGLAELGLRLA
Ga0272428_121110823300031520RockVKLVAELRPGVMTETEVARIERDEQAGLAELGLRLAEAKQ
Ga0272428_140459913300031520RockVAKLVWRVKLVAELRPGVMTETEVARIERDEQASVAEL
Ga0302322_10246481013300031902FenMGSRDEGERVPKLVWRVNLVAEFETGETTEVEVARLERDEQAGLADLGLRLAEAK
Ga0308175_10319200013300031938SoilVAKLVWRVRLVAELEPGVVTETELARIERDAQASLAELGLRRDEA
Ga0307415_10155639023300032126RhizosphereMQISNPPGSRKEGGLVPKLVWRVKLVAELEPGVTEETEVACLERGEEAGLADLGL
Ga0272424_127126713300032162RockLPKLVWRVKLIAELRPGVMTETEVARIERDEQAGLAELGLRL
Ga0272423_102007013300033168RockVPKLVWRVKLVAELRPGVTTETEVTRIERDEQAGLVEL
Ga0272423_106020333300033168RockVPKLVWRVKLVAELRPGVMTETEVARIERDEQAGLAEL
Ga0272431_1020809023300033181RockVPKLVWRVKLVAELRPGVMTETEVARIERDEQAGL
Ga0272431_1037162213300033181RockVPKLVWRVKLDAELRPGVTTETEVACIERDEQAGLA
Ga0334790_057314_1266_14183300033887SoilLGSRDEGELVAKLVWRVKLVTELEAGETTEVEVARIECDEQAGLADLGLRL
Ga0334918_064204_1_1353300034000Hypolithic BiocrustVPKLVWRVKLVAELEPGVATETEVARIERGEEAGLAELGLGLEEV
Ga0334936_112846_3_1103300034007BiocrustVPKLLWRVKLVAELEPGVATETEVARIERGEEAGLA
Ga0370485_0193695_2_1243300034358Untreated Peat SoilMPKVVWRVKLVAELHAGEPTEVELACFERDEQVGLADLGLS
Ga0334931_143605_1_1323300034377Sub-Biocrust SoilMGLVPKLVWRVKLVAELRPGVMTETEVARIERDEQAGLADLGLR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.