NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0213840_1016654

Scaffold Ga0213840_1016654


Overview

Basic Information
Taxon OID3300021341 Open in IMG/M
Scaffold IDGa0213840_1016654 Open in IMG/M
Source Dataset NameCoastal seawater microbial communities from Marineland, Florida, United States - SWPA TP2 #2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2904
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (81.82%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Coastal Seawater Microbial Communities From Marineland, Florida, United States

Source Dataset Sampling Location
Location NameUSA: Florida
CoordinatesLat. (o)29.6703Long. (o)-81.2145Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F094834Metagenome105Y

Sequences

Protein IDFamilyRBSSequence
Ga0213840_10166548F094834AGGMAHLNTCRTYKELTGGIWVHHSDPDPNCNDTSHHANYTQENK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.