Basic Information | |
---|---|
Taxon OID | 3300021341 Open in IMG/M |
Scaffold ID | Ga0213840_1016654 Open in IMG/M |
Source Dataset Name | Coastal seawater microbial communities from Marineland, Florida, United States - SWPA TP2 #2 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2904 |
Total Scaffold Genes | 11 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 9 (81.82%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Coastal Seawater Microbial Communities From Marineland, Florida, United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Florida | |||||||
Coordinates | Lat. (o) | 29.6703 | Long. (o) | -81.2145 | Alt. (m) | Depth (m) | 1 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F094834 | Metagenome | 105 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0213840_10166548 | F094834 | AGG | MAHLNTCRTYKELTGGIWVHHSDPDPNCNDTSHHANYTQENK |
⦗Top⦘ |