Metagenome Family F094834

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F094834
Family Type	Metagenome
Number of Sequences	105
Average Sequence Length	42 residues
Representative Sequence	MSHLPTCRTRKELTGNVWVYYSDPDRNCTDQSHVDAYTEETQ
Number of Associated Samples	15
Number of Associated Scaffolds	105

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	90.48 %
% of genes near scaffold ends (potentially truncated)	14.29 %
% of genes from short scaffolds (< 2000 bps)	78.10 %
Associated GOLD sequencing projects	13
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.27

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (48.571 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere (26.667 % of family members)
Environment Ontology (ENVO)	Unclassified (72.381 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (98.095 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 0.00% β-sheet: 17.14% Coil/Unstructured: 82.86%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.27
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.27
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 105 Family Scaffolds
PF12684	DUF3799	17.14
PF09588	YqaJ	7.62
PF13392	HNH_3	3.81
PF13560	HTH_31	2.86
PF00436	SSB	1.90
PF01555	N6_N4_Mtase	0.95
PF00589	Phage_integrase	0.95

COG ID	Name	Functional Category	% Frequency in 105 Family Scaffolds
COG0629	Single-stranded DNA-binding protein	Replication, recombination and repair [L]	1.90
COG2965	Primosomal replication protein N	Replication, recombination and repair [L]	1.90
COG0863	DNA modification methylase	Replication, recombination and repair [L]	0.95
COG1041	tRNA G10 N-methylase Trm11	Translation, ribosomal structure and biogenesis [J]	0.95
COG2189	Adenine specific DNA methylase Mod	Replication, recombination and repair [L]	0.95

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	51.43 %
Unclassified	root	N/A	48.57 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.57 %
Viruses	superkingdom	All Organisms → Viruses	44.76 %
cellular organisms	root	All Organisms → cellular organisms	6.67 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.57 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	44.76 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	6.67 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.57 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	44.76 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	5.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.57 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	44.76 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	5.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.57 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	44.76 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	5.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.57 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	44.76 %
Micrococcales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales	5.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.57 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	44.76 %
Micrococcaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae	4.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.57 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	44.76 %
Arthrobacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter	3.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.57 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	44.76 %
unclassified Arthrobacter	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → unclassified Arthrobacter	2.86 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.57 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	44.76 %
Arthrobacter sp. ISL-69	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → unclassified Arthrobacter → Arthrobacter sp. ISL-69	2.86 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2124908027\|MRS2a_Contig_24981	Not Available	643	Open in IMG/M
3300005288\|Ga0065714_10006028	All Organisms → Viruses → Predicted Viral	4952	Open in IMG/M
3300005288\|Ga0065714_10006642	All Organisms → Viruses → Predicted Viral	3497	Open in IMG/M
3300005288\|Ga0065714_10021402	All Organisms → Viruses → Predicted Viral	1339	Open in IMG/M
3300005288\|Ga0065714_10070442	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae	3867	Open in IMG/M
3300005288\|Ga0065714_10075665	All Organisms → Viruses → Predicted Viral	2877	Open in IMG/M
3300005288\|Ga0065714_10088845	Not Available	2001	Open in IMG/M
3300005288\|Ga0065714_10090518	All Organisms → Viruses → Predicted Viral	1926	Open in IMG/M
3300005288\|Ga0065714_10098976	All Organisms → Viruses → Predicted Viral	1697	Open in IMG/M
3300005288\|Ga0065714_10113237	Not Available	1444	Open in IMG/M
3300005288\|Ga0065714_10113873	All Organisms → Viruses → Predicted Viral	1425	Open in IMG/M
3300005288\|Ga0065714_10126633	All Organisms → Viruses → Predicted Viral	1284	Open in IMG/M
3300005288\|Ga0065714_10129954	All Organisms → Viruses → Predicted Viral	1260	Open in IMG/M
3300005288\|Ga0065714_10135581	All Organisms → Viruses → Predicted Viral	1212	Open in IMG/M
3300005288\|Ga0065714_10145802	All Organisms → Viruses → Predicted Viral	1134	Open in IMG/M
3300005288\|Ga0065714_10165307	All Organisms → Viruses → Predicted Viral	1030	Open in IMG/M
3300005288\|Ga0065714_10205979	Not Available	881	Open in IMG/M
3300005288\|Ga0065714_10255831	Not Available	763	Open in IMG/M
3300005288\|Ga0065714_10268172	Not Available	744	Open in IMG/M
3300005288\|Ga0065714_10317649	Not Available	673	Open in IMG/M
3300005288\|Ga0065714_10350367	Not Available	636	Open in IMG/M
3300005288\|Ga0065714_10382187	Not Available	603	Open in IMG/M
3300005288\|Ga0065714_10386784	Not Available	602	Open in IMG/M
3300005290\|Ga0065712_10045916	Not Available	930	Open in IMG/M
3300005290\|Ga0065712_10070725	Not Available	5760	Open in IMG/M
3300005290\|Ga0065712_10204128	All Organisms → Viruses → Predicted Viral	1088	Open in IMG/M
3300005290\|Ga0065712_10276652	Not Available	868	Open in IMG/M
3300005290\|Ga0065712_10417131	Not Available	703	Open in IMG/M
3300009036\|Ga0105244_10293555	Not Available	753	Open in IMG/M
3300009148\|Ga0105243_10825397	Not Available	916	Open in IMG/M
3300013100\|Ga0157373_10000289	All Organisms → cellular organisms → Bacteria	40419	Open in IMG/M
3300013100\|Ga0157373_10029492	Not Available	3951	Open in IMG/M
3300013100\|Ga0157373_10065940	All Organisms → Viruses → Predicted Viral	2562	Open in IMG/M
3300013100\|Ga0157373_10175961	All Organisms → Viruses → Predicted Viral	1506	Open in IMG/M
3300013100\|Ga0157373_10288992	All Organisms → Viruses → Predicted Viral	1163	Open in IMG/M
3300013100\|Ga0157373_10893342	Not Available	659	Open in IMG/M
3300013100\|Ga0157373_10918708	Not Available	650	Open in IMG/M
3300013102\|Ga0157371_10002952	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales	15821	Open in IMG/M
3300013102\|Ga0157371_10099988	All Organisms → Viruses → Predicted Viral	2057	Open in IMG/M
3300013102\|Ga0157371_10191735	All Organisms → Viruses → Predicted Viral	1463	Open in IMG/M
3300013102\|Ga0157371_10330929	Not Available	1107	Open in IMG/M
3300013102\|Ga0157371_10361463	Not Available	1058	Open in IMG/M
3300013102\|Ga0157371_10539461	Not Available	864	Open in IMG/M
3300013102\|Ga0157371_10569858	Not Available	840	Open in IMG/M
3300013102\|Ga0157371_10608789	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → unclassified Arthrobacter → Arthrobacter sp. ISL-69	813	Open in IMG/M
3300013102\|Ga0157371_10691531	Not Available	763	Open in IMG/M
3300013102\|Ga0157371_10916013	Not Available	665	Open in IMG/M
3300013102\|Ga0157371_11131999	Not Available	601	Open in IMG/M
3300013102\|Ga0157371_11230158	Not Available	578	Open in IMG/M
3300013104\|Ga0157370_10510974	All Organisms → Viruses → Predicted Viral	1103	Open in IMG/M
3300013104\|Ga0157370_10945990	Not Available	781	Open in IMG/M
3300013105\|Ga0157369_10353426	All Organisms → Viruses → Predicted Viral	1526	Open in IMG/M
3300013105\|Ga0157369_10968037	Not Available	872	Open in IMG/M
3300013105\|Ga0157369_11675465	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → unclassified Arthrobacter → Arthrobacter sp. ISL-69	646	Open in IMG/M
3300013105\|Ga0157369_12157393	Not Available	565	Open in IMG/M
3300013306\|Ga0163162_10038259	All Organisms → Viruses → Predicted Viral	4788	Open in IMG/M
3300013306\|Ga0163162_10128245	All Organisms → Viruses → Predicted Viral	2644	Open in IMG/M
3300013306\|Ga0163162_10166175	All Organisms → Viruses → Predicted Viral	2330	Open in IMG/M
3300013306\|Ga0163162_10207063	All Organisms → Viruses → Predicted Viral	2091	Open in IMG/M
3300013306\|Ga0163162_10452826	All Organisms → Viruses → Predicted Viral	1415	Open in IMG/M
3300013306\|Ga0163162_10520603	All Organisms → Viruses → Predicted Viral	1319	Open in IMG/M
3300013306\|Ga0163162_10948982	Not Available	971	Open in IMG/M
3300013306\|Ga0163162_11048494	Not Available	923	Open in IMG/M
3300013306\|Ga0163162_11291409	Not Available	829	Open in IMG/M
3300013306\|Ga0163162_11351550	Not Available	810	Open in IMG/M
3300013306\|Ga0163162_11405368	Not Available	794	Open in IMG/M
3300013306\|Ga0163162_12028036	Not Available	659	Open in IMG/M
3300013306\|Ga0163162_12207232	Not Available	632	Open in IMG/M
3300013308\|Ga0157375_10127784	All Organisms → Viruses → Predicted Viral	2659	Open in IMG/M
3300013308\|Ga0157375_10167914	Not Available	2340	Open in IMG/M
3300013308\|Ga0157375_10239859	All Organisms → Viruses → Predicted Viral	1972	Open in IMG/M
3300013308\|Ga0157375_10276207	All Organisms → Viruses → Predicted Viral	1843	Open in IMG/M
3300013308\|Ga0157375_10332589	Not Available	1684	Open in IMG/M
3300013308\|Ga0157375_10379881	All Organisms → Viruses → Predicted Viral	1579	Open in IMG/M
3300013308\|Ga0157375_10513016	All Organisms → Viruses → Predicted Viral	1362	Open in IMG/M
3300013308\|Ga0157375_10528867	All Organisms → Viruses → Predicted Viral	1342	Open in IMG/M
3300013308\|Ga0157375_10529525	Not Available	1341	Open in IMG/M
3300013308\|Ga0157375_10570320	All Organisms → Viruses → Predicted Viral	1292	Open in IMG/M
3300013308\|Ga0157375_10615381	Not Available	1244	Open in IMG/M
3300013308\|Ga0157375_10648949	All Organisms → Viruses → Predicted Viral	1212	Open in IMG/M
3300013308\|Ga0157375_10730504	All Organisms → Viruses → Predicted Viral	1142	Open in IMG/M
3300013308\|Ga0157375_10748067	All Organisms → Viruses → Predicted Viral	1129	Open in IMG/M
3300013308\|Ga0157375_10753865	All Organisms → Viruses → Predicted Viral	1125	Open in IMG/M
3300013308\|Ga0157375_10885295	All Organisms → Viruses → Predicted Viral	1038	Open in IMG/M
3300013308\|Ga0157375_11424267	Not Available	817	Open in IMG/M
3300013308\|Ga0157375_11548857	Not Available	783	Open in IMG/M
3300013308\|Ga0157375_11594813	Not Available	772	Open in IMG/M
3300013308\|Ga0157375_12200530	Not Available	657	Open in IMG/M
3300013308\|Ga0157375_13251678	Not Available	542	Open in IMG/M
3300013308\|Ga0157375_13353055	Not Available	534	Open in IMG/M
3300013308\|Ga0157375_13755532	Not Available	504	Open in IMG/M
3300013308\|Ga0157375_13802982	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → unclassified Arthrobacter → Arthrobacter sp. ISL-69	501	Open in IMG/M
3300017792\|Ga0163161_10023167	Not Available	4378	Open in IMG/M
3300017792\|Ga0163161_10049801	All Organisms → Viruses → Predicted Viral	3029	Open in IMG/M
3300017792\|Ga0163161_10069785	All Organisms → Viruses → Predicted Viral	2569	Open in IMG/M
3300017792\|Ga0163161_10079521	All Organisms → Viruses → Predicted Viral	2411	Open in IMG/M
3300017792\|Ga0163161_10130393	All Organisms → Viruses → Predicted Viral	1896	Open in IMG/M
3300017792\|Ga0163161_10155803	All Organisms → Viruses → Predicted Viral	1739	Open in IMG/M
3300017792\|Ga0163161_10364016	All Organisms → Viruses → Predicted Viral	1152	Open in IMG/M
3300017792\|Ga0163161_10416484	All Organisms → Viruses → Predicted Viral	1080	Open in IMG/M
3300017792\|Ga0163161_10950489	Not Available	731	Open in IMG/M
3300017792\|Ga0163161_11659310	Not Available	565	Open in IMG/M
3300021341\|Ga0213840_1016654	All Organisms → Viruses → Predicted Viral	2904	Open in IMG/M
3300025728\|Ga0207655_1055342	All Organisms → Viruses → Predicted Viral	1571	Open in IMG/M
3300032002\|Ga0307416_100014923	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter	5345	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	99.05%
Environmental	Environmental	0.95%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	99.05%
Aquatic	Environmental → Aquatic	0.95%

Habitat	Taxonomy	Distribution
Rhizosphere	Host-Associated → Plants → Rhizosphere	50.48%
Rhizoplane	Host-Associated → Plants → Rhizoplane	48.57%
Marine	Environmental → Aquatic → Marine	0.95%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	50.48%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	26.67%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	21.90%
Coastal	Environmental → Aquatic → Marine → Coastal	0.95%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	50.48%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	26.67%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	21.90%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	0.95%

Habitat	Taxonomy	Distribution
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere	26.67%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	23.81%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	22.86%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	21.90%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.86%
Seawater	Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater	0.95%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.95%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2124908027	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1	Host-Associated	Open in IMG/M
3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1	Host-Associated	Open in IMG/M
3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1	Host-Associated	Open in IMG/M
3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Host-Associated	Open in IMG/M
3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Host-Associated	Open in IMG/M
3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Host-Associated	Open in IMG/M
3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300021341	Coastal seawater microbial communities from Marineland, Florida, United States - SWPA TP2 #2	Environmental	Open in IMG/M
3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
MRS2a_00816190	2124908027	Miscanthus Rhizosphere	MAHLNTCRTRKELTGNVWVYYSEPDRNCQDTSHADAYTEEVQ
Ga0065714_100060286	3300005288	Miscanthus Rhizosphere	MAHLNTCRTRKELTGNVWVYYSEPDRNCQDTSHADAYTEEVQ*
Ga0065714_100066424	3300005288	Miscanthus Rhizosphere	MSHTPSCTTRKELTGNVWVYYSDPDRNCTDQSHVDAYTEETQ*
Ga0065714_100214022	3300005288	Miscanthus Rhizosphere	MSHLPTCRTRKXLTGNVWVYYSEPDRNCTDQSHVDAYTQENQ*
Ga0065714_100704424	3300005288	Miscanthus Rhizosphere	MAHLTTCRTRKELTGNVWVYYSDPDQNCTDQSHHDAYTEESK*
Ga0065714_100756657	3300005288	Miscanthus Rhizosphere	MAHLNTCRTRKELTGNVWVYYSDPDRNCTDQSHVDAYTEEVQ*
Ga0065714_100888457	3300005288	Miscanthus Rhizosphere	VSHLPTCRTRKELTGNVWVYYSEPDRNCQDTSHADAYTEEVQ*
Ga0065714_100905187	3300005288	Miscanthus Rhizosphere	MSHTQTCRTRKELTGNVWVYYSEPDRNCQDTSHVDAYTEETQ*
Ga0065714_100989766	3300005288	Miscanthus Rhizosphere	MSHLPTCRTRKELTGNVWVYYSDPDRNRTDQSHTDAYTEENQ*
Ga0065714_101132372	3300005288	Miscanthus Rhizosphere	VSHLPTCRTRKELTGNVWVYYSDPDRNCTDQSHVDAYTEENQ*
Ga0065714_101138733	3300005288	Miscanthus Rhizosphere	MAHLNTCRTRKELTGNVWVYYSDPDRNCNDQSHVDAYTEETQ*
Ga0065714_101266334	3300005288	Miscanthus Rhizosphere	MAHLNTCRTRKELTGNVWVYYSDPDRNCTDQSHVDAYTEEQQ*
Ga0065714_101299542	3300005288	Miscanthus Rhizosphere	MAHLNTCRTRKELTGNVWVYYSEPDRNCTDQSHVDAYTEETP*
Ga0065714_101355815	3300005288	Miscanthus Rhizosphere	MSHLPTCRTRKELTGNVWVYYSEPDRNCTDQSHVDAYTQETQ*
Ga0065714_101458021	3300005288	Miscanthus Rhizosphere	MAHLNTCRTRKELTGNVWVYYSEPDRNCTDQSHVDAYTEETQ*
Ga0065714_101653074	3300005288	Miscanthus Rhizosphere	MSHTPSCRTRKELTGNLWVYYSEPDRNCTDQSHVDAYTEEQQ*
Ga0065714_102059793	3300005288	Miscanthus Rhizosphere	MAHLNTCRTRKELTGNVWVFYSEPDRNCNDQSHVDAYTEETR*
Ga0065714_102558312	3300005288	Miscanthus Rhizosphere	MAHLNTCQTRKELTGNVWVYYSEPDRNCTDQSHVDAYTEETP*
Ga0065714_102681721	3300005288	Miscanthus Rhizosphere	VSHLPTCRTRKELTGNVWVYYAEPDRNCADQSHVDAYTEETQ*
Ga0065714_103176491	3300005288	Miscanthus Rhizosphere	MSHTPSCRTRKELTGNVWVYYSEPDRNCTDQSHVDAYTEEVQ*
Ga0065714_103503673	3300005288	Miscanthus Rhizosphere	MSHLPTCRTRKELTGNVWVYYSDPDRNCTDQSHVDAYTEET
Ga0065714_103821872	3300005288	Miscanthus Rhizosphere	MTHTPTCRTRKELTGNVWVYYSEPDRNCNDQSHVDAYTEETQ*
Ga0065714_103867843	3300005288	Miscanthus Rhizosphere	MSHTPTCRTRKELTGNVWVYYSDPDRNCTDQSHVDAYTEEVQ*
Ga0065712_100459162	3300005290	Miscanthus Rhizosphere	VAHTPSCRTRKELTGNVWVYYSEPDRNCTDQSHVDAYTEETP*
Ga0065712_100707259	3300005290	Miscanthus Rhizosphere	VSHLPTCRTRKELTGNVWVYYSDPDRNCTDQSHVDAYTEEVQ*
Ga0065712_102041282	3300005290	Miscanthus Rhizosphere	VSHLATCRTRKELTGNVWVYYSDPDRNCTDQSHVDAYTEETQ*
Ga0065712_102766522	3300005290	Miscanthus Rhizosphere	MSHTPSCRTRKELTGNVWVYYSEPDRNCTDQSHVDAYTQETQ*
Ga0065712_104171311	3300005290	Miscanthus Rhizosphere	VSHLPTCRTRKELTGNVWVYYAEPDRNCTDQSHVDAYTEENQ*
Ga0105244_102935552	3300009036	Miscanthus Rhizosphere	MSHTPSCTTRKELTGNVWVYYSEPDRNCTDQSHVDAYTEEVQ*
Ga0105243_108253973	3300009148	Miscanthus Rhizosphere	MSHTPSCRTRKELTGNVWVYYSDPDRNCTYQSHVGAYTEETQ*
Ga0157373_1000028915	3300013100	Corn Rhizosphere	MAHLNTCRAYKELTGGIWVHHSDPDPQCQDTSHHANYTQEQQ*
Ga0157373_100294927	3300013100	Corn Rhizosphere	MSHTPLCTTRKELTGNVWVYYSDPDRNCTDQSHVDAYTEETQ*
Ga0157373_100659405	3300013100	Corn Rhizosphere	MAHLNTCRTRKELTGNVWVYYSEPDRNCTDQSHVDAYTEENQ*
Ga0157373_101759613	3300013100	Corn Rhizosphere	MSHTPSCRTRKELAGNVWVYYSDPDRNCTDQSHVDAYTEVTQ*
Ga0157373_102889924	3300013100	Corn Rhizosphere	MSHLPTCRTRKELTGNVWVYYSDPDRNCTDQSHVDAYTQENQ*
Ga0157373_108933424	3300013100	Corn Rhizosphere	TRKELTGNVWVYYSEPDRNCTDQSHVDAYTEENQ*
Ga0157373_109187083	3300013100	Corn Rhizosphere	MSHLPTCRTRKELTGNVWVYYSDPDRNCTDQSHVDAYTEEQQ*
Ga0157371_100029529	3300013102	Corn Rhizosphere	MTHPNTCRTRKELTGGIWVEFSDPDPQCKDKSHHDAYTEETK*
Ga0157371_100999882	3300013102	Corn Rhizosphere	MSHTPSCTTRKELTGNVWVHYSTPDPDCTDKSHHDAYTEETQ*
Ga0157371_101917353	3300013102	Corn Rhizosphere	MSHLPTCRTRKELTGNVWVYYSEPDRNCNDQSHVDAYTEETQ*
Ga0157371_103309294	3300013102	Corn Rhizosphere	MSHLPTCRTRKELTGNVWVYYSEPDRKCNDQSHVDAYTQETQ*
Ga0157371_103614631	3300013102	Corn Rhizosphere	TCRTRKELTGNVWVYYSDPDRNCTDQSHVDAYTEETP*
Ga0157371_105394613	3300013102	Corn Rhizosphere	MSHLNTCRTRKELTGNVWVYYSDPDRNCTDQSHVDAYTEETQ*
Ga0157371_105698585	3300013102	Corn Rhizosphere	VSHTPSCRTRKELTGNVLVYYSDPDRNCTDQSHVDA
Ga0157371_106087893	3300013102	Corn Rhizosphere	VSHLATCRTRKELTGNVWVYYSDPDRNCTDQSHVDAYTEEQQ*
Ga0157371_106915311	3300013102	Corn Rhizosphere	QEQAMAHLNTCRTRKELTGNVWVYYSDPDRNCTDQSHVDAYTEETQ*
Ga0157371_109160132	3300013102	Corn Rhizosphere	VSHLPTCRTRKELTGNVWVYYSEPDRNCTDQSHVDAYTQENQ*
Ga0157371_111319991	3300013102	Corn Rhizosphere	EQAMAHLNTCRTRKELTGNVWVYYSDPDRNCTDQSHVDAYTEETQ*
Ga0157371_112301581	3300013102	Corn Rhizosphere	MAHLPTCRARKELTGNVWVYYSDPDRNCQDTSHVDAYTEEQQ*
Ga0157370_105109741	3300013104	Corn Rhizosphere	TCRTRKELTGNVWVYYSDPDRNRTDQSHTDAYTEENQ*
Ga0157370_109459903	3300013104	Corn Rhizosphere	MSHLPTCRTRKELTGNVWVYYSEPDRNCTDQSHVDAYTQENQ*
Ga0157369_103534266	3300013105	Corn Rhizosphere	MSHLPTCRTRKELTGNVWVYYSDPDRNCNDQSHVDAYTEETQ*
Ga0157369_109680371	3300013105	Corn Rhizosphere	MAHLNTCRTRKELTGNVWVYYSDPDRNCTDQSHVDAYTEETQ*
Ga0157369_116754652	3300013105	Corn Rhizosphere	VSHLATCRTRKELTGNVWVYYSDPDRNCTDQSHVDAYTEE
Ga0157369_121573931	3300013105	Corn Rhizosphere	MSHTPSCRTRKELTGNVWVYYSEPDRNCQDTSHVDAYTEETQ*
Ga0163162_100382597	3300013306	Switchgrass Rhizosphere	MSHLPTCRTRKELTGNVWVYYSDPDRNCTDQSHVDAYTEETQ*
Ga0163162_101282457	3300013306	Switchgrass Rhizosphere	AHLNTCQTRKELTGNVWVYYSEPDRNCTDQSHVDAYTEETQ*
Ga0163162_101661753	3300013306	Switchgrass Rhizosphere	VSHTPSCRTRKELTGNVWVYYSDPDRNCTDQSHVDAYTQETQ*
Ga0163162_102070637	3300013306	Switchgrass Rhizosphere	MSHLPTCRTRKELTGNVWVYYSDPDRNCTDQSHADAYTEEVQ*
Ga0163162_104528263	3300013306	Switchgrass Rhizosphere	MSHTPTCKTRKELTGNVWVYYSEPDRKCNDQSHVDAYTQETQ*
Ga0163162_105206035	3300013306	Switchgrass Rhizosphere	VAHTPSCRTRKELTGNVWVYYSEPDRNCTDQSHVDAYTEESQ*
Ga0163162_109489823	3300013306	Switchgrass Rhizosphere	MSHTPSCATRKELTGNVWVHYSSPDPDCTDQSHHDAYTEESA*
Ga0163162_110484943	3300013306	Switchgrass Rhizosphere	MSHLPTCRTRKELTGNVWVYYSDPDRNCNDQSHVGAYTEEVQ*
Ga0163162_112914091	3300013306	Switchgrass Rhizosphere	MSHTPSCTTRKELTGNVWVHYSSPDPDCTDQSHHD
Ga0163162_113515504	3300013306	Switchgrass Rhizosphere	GVPVMSHLPTCRTRKELTGNVWVYYSDPDRNCTDQSHVDAYTEETQ*
Ga0163162_114053681	3300013306	Switchgrass Rhizosphere	MSHLPTCRTRKELTGNVWVYYSDPDRNCTDQTHVDAYTEETQ*
Ga0163162_120280362	3300013306	Switchgrass Rhizosphere	VSHLPTCRTRKELTGNVWVYYSEPDRNCTDQSHVDAYTEEVQ*
Ga0163162_122072324	3300013306	Switchgrass Rhizosphere	AHLNTCQTRKELTGNVWVYYSEPDRNCTDQSHVDAYTEETP*
Ga0157375_1012778410	3300013308	Miscanthus Rhizosphere	MSHTPSCTTRKELTGNVWVYYSEPDRNCTDQSHVDAYTEETQ*
Ga0157375_101679144	3300013308	Miscanthus Rhizosphere	MSHLPTCRTRKELTGNVWVYYSDPDRNCQDTSHVDAYTEETQ*
Ga0157375_102398595	3300013308	Miscanthus Rhizosphere	MAHLNTCRTRKELTGNVWVYYSEPDRNCTDQSHVDAYTEENK*
Ga0157375_102762075	3300013308	Miscanthus Rhizosphere	MSHTPTCRTRKELTGNVWVYYSEPDRNCTDQSHVDAYTEEVQ*
Ga0157375_103325894	3300013308	Miscanthus Rhizosphere	MSHTPSCRTRKELTGNVWVFYSEPDRNCTDQSHVDAYTEEVQ*
Ga0157375_103798816	3300013308	Miscanthus Rhizosphere	MSHTPSCRTRKELTGNVWVYYSEPDRNCTDQSHVDAYTQENQ*
Ga0157375_105130163	3300013308	Miscanthus Rhizosphere	MSHTPSCTTRKELAGNVWVYYSDPDRNCTDQSHVDAYTEETK*
Ga0157375_105288675	3300013308	Miscanthus Rhizosphere	MSHLPTCRTRKELTGNVWVYYSEPDRNCTDQSHVDAYTEENQ*
Ga0157375_105295251	3300013308	Miscanthus Rhizosphere	MSHTPTCRTRKELTGNVWVYYSEPDRNCQDTSHADAYTEEVQ*
Ga0157375_105703203	3300013308	Miscanthus Rhizosphere	MSHLPTCRTRKELTGNVWVYFSEPDLNCQDASHADAYTEEVQ*
Ga0157375_106153814	3300013308	Miscanthus Rhizosphere	MSHLPTCRTRKELTGNVWVYYSDPDRNCTDQSHVDAYTEEGQ*
Ga0157375_106489491	3300013308	Miscanthus Rhizosphere	CRTRKELTGNVWVYYSDPDRNCTDQSHVDAYTQEGQ*
Ga0157375_107305045	3300013308	Miscanthus Rhizosphere	VSHTPSCRTRKELTGNVLVYYSDPDRNCTDQSHVDAYTEEVQ*
Ga0157375_107480673	3300013308	Miscanthus Rhizosphere	VSHTPTCRTRKELTGNVWVYYSDPDRNCTDQSHVDAYTEETQ*
Ga0157375_107538654	3300013308	Miscanthus Rhizosphere	MSHLPTCRTRKELTGNVWVYYSEPDRNCTDQSHVDAYTEEVQ*
Ga0157375_108852952	3300013308	Miscanthus Rhizosphere	MSHTQTCRTRKELTGNVWVYYSEPDRNCTDQSHVDAYTEENQ*
Ga0157375_114242675	3300013308	Miscanthus Rhizosphere	MAHLNTCRTRKELTGNVWVYYSEPDRNCTDQSHVDAYTEEGQ*
Ga0157375_115488572	3300013308	Miscanthus Rhizosphere	MSHTPTCRTRKELTGNVWVYYSEPDRNCNDQSHVAAYTEETQ*
Ga0157375_115948132	3300013308	Miscanthus Rhizosphere	MSHTQTCKTRKELTGNVWVYYSDPDRNCTDQSHVDAYTEEVQ*
Ga0157375_122005302	3300013308	Miscanthus Rhizosphere	MAHLNTCRTRKELTGNVWVYYSDPDRNCTDQSHVDAYTEEQP*
Ga0157375_132516783	3300013308	Miscanthus Rhizosphere	MSHTPSCTTRKELTGNVWVYYSEPDRNCTDQSHVDAYTQENQ*
Ga0157375_133530551	3300013308	Miscanthus Rhizosphere	MSHLPTCRTRKELTGNVWVYYSDPDRNCQDTSHADAYTEEVQ*
Ga0157375_137555321	3300013308	Miscanthus Rhizosphere	RTRKELTGNVWVYYSDPDRNRTDQSHTDAYTEENQ*
Ga0157375_138029822	3300013308	Miscanthus Rhizosphere	VSHLPTCRTRKELTGNVWVYYSDPDRNCTDQSHVDAYTQENQ*
Ga0163161_100231676	3300017792	Switchgrass Rhizosphere	VSHTPSCRTRKELTGNVWVYYSDPDRNCTDQSHVDAYTQETQ
Ga0163161_100498015	3300017792	Switchgrass Rhizosphere	MAHAPSCTTRKELTGNVWVYYSDPDRNCTDQSHVDAYTEETP
Ga0163161_100697857	3300017792	Switchgrass Rhizosphere	MSHLPTCRTRKELTGNVWVEYSEPDRNCTDQSHVDAYTEETQ
Ga0163161_100795214	3300017792	Switchgrass Rhizosphere	MSHTPSCTTRKELTGNVWVYYSDPDRNCTDQSHVDAYTEETQ
Ga0163161_101303935	3300017792	Switchgrass Rhizosphere	MAHLNTCQTRKELTGNVWVYYSEPDRNCTDQSHVDAYTEETP
Ga0163161_101558033	3300017792	Switchgrass Rhizosphere	MSHTPQCRIRKELTGNVWVYYSDPDPCCNDKSHHDAYTEESA
Ga0163161_103640162	3300017792	Switchgrass Rhizosphere	MAHLNTCRTRKELTGNVWVYYSDPDRNCNDQSHVDAYTEETQ
Ga0163161_104164841	3300017792	Switchgrass Rhizosphere	MSHLPTCRTRKELTGNVWVYYSDPDRNRTDQSHTDAYTEENQ
Ga0163161_109504892	3300017792	Switchgrass Rhizosphere	MSHLPTCRTRKELTGNVWVYYSDPDRNCTDQSHVDAYTEETQ
Ga0163161_116593102	3300017792	Switchgrass Rhizosphere	MSHLPTCRTRKELTGNVWVYYSDPDRNCTDQSHVDAYTEEGQ
Ga0213840_10166548	3300021341	Seawater	MAHLNTCRTYKELTGGIWVHHSDPDPNCNDTSHHANYTQENK
Ga0207655_10553422	3300025728	Miscanthus Rhizosphere	MAHLNTCRTRKELTGNVWVYYSDPDRNCTDQSHVDAYTEETQ
Ga0307416_10001492310	3300032002	Rhizosphere	MSHLNTCRIRKELTGNIWTYYSDPDENCKDASHDTYYTEATK

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F094834

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences