Scaffold Ga0214507_118588

Overview

Basic Information

• Taxon OID: 3300021310
• Scaffold ID: Ga0214507_118588
• Source Dataset Name: Enriched fungal communities from goat fecal pellet, Isla Vista, California, United States - Bagasse, Gen5, Rep 2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 885
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Prevotella → Prevotella ruminicola (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Goat Feces → Determining The Genomic Basis For Interactions Between Gut Fungi And Methanogenic Archaea

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 34.4149
  • Long. (^o): -119.841
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F081939	Metagenome / Metatranscriptome	114	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0214507_1185882	F081939	GGAG	MVKKKEKTLTKREKVGMLADKLNEAINSCKLEPTEELDIFAESVALLIAYWGKISDWSPIEKASYVGYVTTTIMEKGLDAEIKSFEEHRKSMKPQIGN