3300021310: Enriched fungal communities from goat fecal pellet, Isla Vista, California, United States - Bagasse, Gen5, Rep 2

Overview

Basic Information

• IMG/M Taxon OID: 3300021310
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0118397 | Gp0242240 | Ga0214507
• Sample Name: Enriched fungal communities from goat fecal pellet, Isla Vista, California, United States - Bagasse, Gen5, Rep 2
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 166997797
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Prevotella → Prevotella ruminicola	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Determining The Genomic Basis For Interactions Between Gut Fungi And Methanogenic Archaea
• Type: Host-Associated
• Taxonomy: Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Goat Feces → Determining The Genomic Basis For Interactions Between Gut Fungi And Methanogenic Archaea

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal distal gut

Location Information

• Location: USA: California
• Coordinates
  • Lat. (^o): 34.4149
  • Long. (^o): -119.841
  • Alt. (m): N/A
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F081939	Metagenome / Metatranscriptome	114	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0214507_118588	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Prevotella → Prevotella ruminicola	885

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0214507_118588	Ga0214507_1185882	F081939	MVKKKEKTLTKREKVGMLADKLNEAINSCKLEPTEELDIFAESVALLIAYWGKISDWSPIEKASYVGYVTTTIMEKGLDAEIKSFEEHRKSMKPQIGN