Scaffold Ga0214511_1021964

Overview

Basic Information

• Taxon OID: 3300021288
• Scaffold ID: Ga0214511_1021964
• Source Dataset Name: Enriched fungal communities from goat fecal pellet, Isla Vista, California, United States - Reed Canary Grass, Gen5, Rep 3, Penicillin and Streptomycin
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1314
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Chytridiomycota → Chytridiomycota incertae sedis → Neocallimastigomycetes → Neocallimastigales → Neocallimastigaceae → Neocallimastix (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Goat Feces → Determining The Genomic Basis For Interactions Between Gut Fungi And Methanogenic Archaea

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 34.4149
  • Long. (^o): -119.841
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F046107	Metagenome / Metatranscriptome	151	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0214511_10219641	F046107	N/A	NKKEIKPRSNIFKIDNVVSTKLSPDSSFIELLGRDSPFVEIGEEPVLLLCLISTTSTLLVKFGILQYLSNNSLKRTT