Scaffold Ga0223826_10081046

Overview

Basic Information

• Taxon OID: 3300021256
• Scaffold ID: Ga0223826_10081046
• Source Dataset Name: Sheep rumen microbial communities from New Zealand - Tag 1283 SPADES assembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 2957
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (71.43%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Foregut → Rumen → Cattle And Sheep Rumen → Cattle And Sheep Rumen Microbial Communities From New Zealand, For Comparative Studies

Source Dataset Sampling Location

• Location Name: New Zealand
• Coordinates
  • Lat. (^o): -42.26
  • Long. (^o): 171.6

Associated Families

Family	Category	Number of Sequences	3D Structure?
F072949	Metagenome / Metatranscriptome	120	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0223826_100810461	F072949	AGG	MAKRKSVVNKIVVDKNAAQFMRTAENLARKGKTNKKLHGRNANLKAKKYDIAIA