NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210405_10114618

Scaffold Ga0210405_10114618


Overview

Basic Information
Taxon OID3300021171 Open in IMG/M
Scaffold IDGa0210405_10114618 Open in IMG/M
Source Dataset NameForest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2129
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Barre Woods Harvard Forest Lter Site, Petersham, Massachusetts, United States

Source Dataset Sampling Location
Location NameUSA: Massachusetts
CoordinatesLat. (o)42.481016Long. (o)-72.178343Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007949Metagenome / Metatranscriptome342Y
F041945Metagenome / Metatranscriptome159Y
F086222Metagenome / Metatranscriptome111Y

Sequences

Protein IDFamilyRBSSequence
Ga0210405_101146181F041945AGAAGMEPAQLGSGQMSPEQMVAEIKRQQKEIEYLRRQREILKKAMSILGEEPNTGIR
Ga0210405_101146182F086222GGAGVITLRKEETGVLVMELSEHLWSEDLELVVPAVHDAARSPQNPLLLVVEIGTDFDTPPLAVLRQILQPGILAQNRPSRVAVLTTFTQEFKATAASKNNSEIQIRFFSPNQRYEAKAWLLAFATPHSLPPILD
Ga0210405_101146183F007949GAGVDFERHSFVAWNPRFLEHTGFSEDEMKSSKAEELLTFGDSWFPLSDEKAQTVEYIACAAKRPFGADSAPGFAVRSQGEIGYVMLDVFDSSSAQFEQGRNVGHEEERNRVIKAFHEKVSSSMIAALFLIETAKSELEEAGLPQAEAVSKASDILAETTENAATR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.