Scaffold Ga0196978_1000007

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0196978_1000007

Scaffold Ga0196978_1000007

Overview

Basic Information
Taxon OID	3300021067 Open in IMG/M
Scaffold ID	Ga0196978_1000007 Open in IMG/M
Source Dataset Name	Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_20-13C
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	455919
Total Scaffold Genes	337 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	267 (79.23%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Sand → Desert → Soil → Systems Level Insights Into Methane Cycling In Arid And Semi-Arid Ecosystems

Source Dataset Sampling Location
Location Name	USA: California
Coordinates	Lat. (^o)	33.305	Long. (^o)	-116.2547	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F092671	Metagenome	107	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0196978_1000007125	F092671	AGGA	VTDAPLQIDLGSVETLLGNLQFTFVVSAEGDAHVQLYATDPSKAGGGGVVLMLDAQGLERLKAIVKGADRVIDRMIAEGKIKRMVLPY

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.