Scaffold Ga0196973_1047857

Overview

Basic Information

• Taxon OID: 3300021061
• Scaffold ID: Ga0196973_1047857
• Source Dataset Name: Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5-13C
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 813
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Sand → Desert → Soil → Systems Level Insights Into Methane Cycling In Arid And Semi-Arid Ecosystems

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 33.3049
  • Long. (^o): -116.2547
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F042553	Metagenome / Metatranscriptome	158	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0196973_10478572	F042553	N/A	MGRLIVLILVVGAVWYAWQKGLIAQWFNTAVDSSVEGAKRTQRDATKVRPA