| Basic Information | |
|---|---|
| Taxon OID | 3300021046 Open in IMG/M |
| Scaffold ID | Ga0215015_10860572 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Colorado |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2502 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (80.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Czos Across The Us |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Huntingdon County, Pennsylvania, United States | |||||||
| Coordinates | Lat. (o) | 40.6949 | Long. (o) | -77.9199 | Alt. (m) | Depth (m) | .9 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F020969 | Metagenome / Metatranscriptome | 221 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0215015_108605724 | F020969 | AGGAGG | MHQILLIIALICFIVDALASRMKFRAPFGLLPGGLAFLTASYLL |
| ⦗Top⦘ |