| Basic Information | |
|---|---|
| Family ID | F020969 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 221 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MSLSKIFLIVALICFILDALAGRMKFRAPFGLLPGGLAFLTASFLF |
| Number of Associated Samples | 153 |
| Number of Associated Scaffolds | 221 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 85.97 % |
| % of genes near scaffold ends (potentially truncated) | 19.00 % |
| % of genes from short scaffolds (< 2000 bps) | 75.11 % |
| Associated GOLD sequencing projects | 124 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (80.995 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (26.697 % of family members) |
| Environment Ontology (ENVO) | Unclassified (45.701 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (71.493 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 48.65% β-sheet: 0.00% Coil/Unstructured: 51.35% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 221 Family Scaffolds |
|---|---|---|
| PF01883 | FeS_assembly_P | 35.29 |
| PF00355 | Rieske | 18.10 |
| PF01458 | SUFBD | 12.22 |
| PF00437 | T2SSE | 10.41 |
| PF12850 | Metallophos_2 | 0.45 |
| PF00106 | adh_short | 0.45 |
| PF02410 | RsfS | 0.45 |
| PF02911 | Formyl_trans_C | 0.45 |
| PF01592 | NifU_N | 0.45 |
| PF04055 | Radical_SAM | 0.45 |
| PF14890 | Intein_splicing | 0.45 |
| PF01613 | Flavin_Reduct | 0.45 |
| PF12367 | PFO_beta_C | 0.45 |
| PF02780 | Transketolase_C | 0.45 |
| COG ID | Name | Functional Category | % Frequency in 221 Family Scaffolds |
|---|---|---|---|
| COG0719 | Fe-S cluster assembly scaffold protein SufB | Posttranslational modification, protein turnover, chaperones [O] | 12.22 |
| COG0223 | Methionyl-tRNA formyltransferase | Translation, ribosomal structure and biogenesis [J] | 0.45 |
| COG0799 | Ribosomal silencing factor RsfS, regulates association of 30S and 50S subunits | Translation, ribosomal structure and biogenesis [J] | 0.45 |
| COG0822 | Fe-S cluster assembly scaffold protein IscU, NifU family | Posttranslational modification, protein turnover, chaperones [O] | 0.45 |
| COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 0.45 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 81.00 % |
| Unclassified | root | N/A | 19.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001086|JGI12709J13192_1005230 | All Organisms → cellular organisms → Bacteria | 1333 | Open in IMG/M |
| 3300001086|JGI12709J13192_1013380 | Not Available | 648 | Open in IMG/M |
| 3300001089|JGI12683J13190_1007467 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
| 3300001154|JGI12636J13339_1042156 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300001160|JGI12654J13325_1005645 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300001160|JGI12654J13325_1007881 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300001160|JGI12654J13325_1012772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 601 | Open in IMG/M |
| 3300001182|JGI12668J13544_1009594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 529 | Open in IMG/M |
| 3300001545|JGI12630J15595_10001214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 5511 | Open in IMG/M |
| 3300001593|JGI12635J15846_10234679 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
| 3300001593|JGI12635J15846_10331811 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300001661|JGI12053J15887_10001757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 10264 | Open in IMG/M |
| 3300001661|JGI12053J15887_10395508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 665 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100991068 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300002557|JGI25381J37097_1006681 | All Organisms → cellular organisms → Bacteria | 2034 | Open in IMG/M |
| 3300002560|JGI25383J37093_10132012 | Not Available | 683 | Open in IMG/M |
| 3300002561|JGI25384J37096_10233445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 537 | Open in IMG/M |
| 3300002562|JGI25382J37095_10088407 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300002562|JGI25382J37095_10089113 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
| 3300002911|JGI25390J43892_10126930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 585 | Open in IMG/M |
| 3300002914|JGI25617J43924_10240626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 610 | Open in IMG/M |
| 3300005167|Ga0066672_10009174 | All Organisms → cellular organisms → Bacteria | 4658 | Open in IMG/M |
| 3300005167|Ga0066672_10065180 | Not Available | 2137 | Open in IMG/M |
| 3300005167|Ga0066672_10768650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 609 | Open in IMG/M |
| 3300005167|Ga0066672_10947146 | Not Available | 530 | Open in IMG/M |
| 3300005171|Ga0066677_10001406 | All Organisms → cellular organisms → Bacteria | 8529 | Open in IMG/M |
| 3300005171|Ga0066677_10065624 | All Organisms → cellular organisms → Bacteria | 1852 | Open in IMG/M |
| 3300005172|Ga0066683_10137326 | All Organisms → cellular organisms → Bacteria | 1497 | Open in IMG/M |
| 3300005174|Ga0066680_10022932 | All Organisms → cellular organisms → Bacteria | 3438 | Open in IMG/M |
| 3300005175|Ga0066673_10064212 | All Organisms → cellular organisms → Bacteria | 1888 | Open in IMG/M |
| 3300005176|Ga0066679_10489792 | Not Available | 803 | Open in IMG/M |
| 3300005176|Ga0066679_10957345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 536 | Open in IMG/M |
| 3300005177|Ga0066690_10199053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1332 | Open in IMG/M |
| 3300005178|Ga0066688_10114044 | All Organisms → cellular organisms → Bacteria | 1664 | Open in IMG/M |
| 3300005178|Ga0066688_10349871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 957 | Open in IMG/M |
| 3300005179|Ga0066684_10148277 | All Organisms → cellular organisms → Bacteria | 1486 | Open in IMG/M |
| 3300005179|Ga0066684_10234433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1199 | Open in IMG/M |
| 3300005179|Ga0066684_10269872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1122 | Open in IMG/M |
| 3300005181|Ga0066678_10117369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1630 | Open in IMG/M |
| 3300005184|Ga0066671_10446477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 830 | Open in IMG/M |
| 3300005434|Ga0070709_10244847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1289 | Open in IMG/M |
| 3300005434|Ga0070709_10308923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1157 | Open in IMG/M |
| 3300005435|Ga0070714_100899093 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300005440|Ga0070705_101288071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 605 | Open in IMG/M |
| 3300005445|Ga0070708_100014675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 6453 | Open in IMG/M |
| 3300005445|Ga0070708_100020074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae | 5628 | Open in IMG/M |
| 3300005445|Ga0070708_100278348 | All Organisms → cellular organisms → Bacteria | 1575 | Open in IMG/M |
| 3300005446|Ga0066686_10215481 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
| 3300005447|Ga0066689_10794341 | Not Available | 588 | Open in IMG/M |
| 3300005454|Ga0066687_10000472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 10747 | Open in IMG/M |
| 3300005454|Ga0066687_10016220 | All Organisms → cellular organisms → Bacteria | 3024 | Open in IMG/M |
| 3300005454|Ga0066687_10058536 | All Organisms → cellular organisms → Bacteria | 1824 | Open in IMG/M |
| 3300005467|Ga0070706_100113745 | All Organisms → cellular organisms → Bacteria | 2520 | Open in IMG/M |
| 3300005468|Ga0070707_100004469 | All Organisms → cellular organisms → Bacteria | 13098 | Open in IMG/M |
| 3300005468|Ga0070707_100383935 | All Organisms → cellular organisms → Bacteria | 1364 | Open in IMG/M |
| 3300005468|Ga0070707_100952526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 823 | Open in IMG/M |
| 3300005471|Ga0070698_100002108 | All Organisms → cellular organisms → Bacteria | 22100 | Open in IMG/M |
| 3300005471|Ga0070698_100131099 | All Organisms → cellular organisms → Bacteria | 2462 | Open in IMG/M |
| 3300005518|Ga0070699_100242053 | All Organisms → cellular organisms → Bacteria | 1611 | Open in IMG/M |
| 3300005536|Ga0070697_100234321 | All Organisms → cellular organisms → Bacteria | 1566 | Open in IMG/M |
| 3300005536|Ga0070697_100546226 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300005542|Ga0070732_10434019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 793 | Open in IMG/M |
| 3300005555|Ga0066692_10622529 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300005557|Ga0066704_10192455 | All Organisms → cellular organisms → Bacteria | 1377 | Open in IMG/M |
| 3300005559|Ga0066700_10017004 | All Organisms → cellular organisms → Bacteria | 3967 | Open in IMG/M |
| 3300005559|Ga0066700_10634021 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300005559|Ga0066700_10826965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 621 | Open in IMG/M |
| 3300005561|Ga0066699_10071902 | All Organisms → cellular organisms → Bacteria | 2203 | Open in IMG/M |
| 3300005561|Ga0066699_10137077 | All Organisms → cellular organisms → Bacteria | 1657 | Open in IMG/M |
| 3300005561|Ga0066699_10589285 | Not Available | 798 | Open in IMG/M |
| 3300005568|Ga0066703_10015659 | All Organisms → cellular organisms → Bacteria | 3796 | Open in IMG/M |
| 3300005568|Ga0066703_10500874 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300005575|Ga0066702_10152548 | All Organisms → cellular organisms → Bacteria | 1368 | Open in IMG/M |
| 3300005586|Ga0066691_10417714 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300005587|Ga0066654_10603942 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300006028|Ga0070717_10287441 | All Organisms → cellular organisms → Bacteria | 1459 | Open in IMG/M |
| 3300006031|Ga0066651_10818485 | Not Available | 506 | Open in IMG/M |
| 3300006032|Ga0066696_10013033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 4085 | Open in IMG/M |
| 3300006032|Ga0066696_10951009 | Not Available | 546 | Open in IMG/M |
| 3300006173|Ga0070716_100819889 | Not Available | 722 | Open in IMG/M |
| 3300007265|Ga0099794_10450416 | Not Available | 675 | Open in IMG/M |
| 3300007982|Ga0102924_1000928 | All Organisms → cellular organisms → Bacteria | 34951 | Open in IMG/M |
| 3300007982|Ga0102924_1066468 | All Organisms → cellular organisms → Bacteria | 1987 | Open in IMG/M |
| 3300009012|Ga0066710_100022696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 7024 | Open in IMG/M |
| 3300009038|Ga0099829_10276534 | All Organisms → cellular organisms → Bacteria | 1373 | Open in IMG/M |
| 3300009038|Ga0099829_10325006 | All Organisms → cellular organisms → Bacteria | 1264 | Open in IMG/M |
| 3300009088|Ga0099830_10992122 | Not Available | 695 | Open in IMG/M |
| 3300009088|Ga0099830_11573402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 548 | Open in IMG/M |
| 3300009089|Ga0099828_11566133 | Not Available | 580 | Open in IMG/M |
| 3300009090|Ga0099827_10000098 | All Organisms → cellular organisms → Bacteria | 29231 | Open in IMG/M |
| 3300009143|Ga0099792_11024401 | Not Available | 553 | Open in IMG/M |
| 3300009400|Ga0116854_1141874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 550 | Open in IMG/M |
| 3300010322|Ga0134084_10011009 | All Organisms → cellular organisms → Bacteria | 2283 | Open in IMG/M |
| 3300010322|Ga0134084_10223200 | Not Available | 669 | Open in IMG/M |
| 3300010323|Ga0134086_10052303 | Not Available | 1387 | Open in IMG/M |
| 3300010325|Ga0134064_10385160 | Not Available | 556 | Open in IMG/M |
| 3300011120|Ga0150983_10163563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 568 | Open in IMG/M |
| 3300011270|Ga0137391_10990603 | Not Available | 684 | Open in IMG/M |
| 3300011994|Ga0120157_1111549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 526 | Open in IMG/M |
| 3300011996|Ga0120156_1045436 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 799 | Open in IMG/M |
| 3300011998|Ga0120114_1006991 | All Organisms → cellular organisms → Bacteria | 2718 | Open in IMG/M |
| 3300012198|Ga0137364_10571142 | Not Available | 851 | Open in IMG/M |
| 3300012200|Ga0137382_10592746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 791 | Open in IMG/M |
| 3300012203|Ga0137399_10033391 | All Organisms → cellular organisms → Bacteria | 3573 | Open in IMG/M |
| 3300012208|Ga0137376_10350916 | All Organisms → cellular organisms → Bacteria | 1281 | Open in IMG/M |
| 3300012208|Ga0137376_10424083 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
| 3300012208|Ga0137376_11656908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 531 | Open in IMG/M |
| 3300012209|Ga0137379_10426668 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
| 3300012356|Ga0137371_11276749 | Not Available | 544 | Open in IMG/M |
| 3300012363|Ga0137390_11961829 | Not Available | 512 | Open in IMG/M |
| 3300012382|Ga0134038_1270054 | All Organisms → cellular organisms → Bacteria | 1684 | Open in IMG/M |
| 3300012389|Ga0134040_1050681 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300012400|Ga0134048_1368091 | All Organisms → cellular organisms → Bacteria | 1637 | Open in IMG/M |
| 3300012683|Ga0137398_10127697 | All Organisms → cellular organisms → Bacteria | 1631 | Open in IMG/M |
| 3300012918|Ga0137396_10533958 | Not Available | 869 | Open in IMG/M |
| 3300013772|Ga0120158_10535568 | Not Available | 507 | Open in IMG/M |
| 3300014150|Ga0134081_10038249 | All Organisms → cellular organisms → Bacteria | 1409 | Open in IMG/M |
| 3300014157|Ga0134078_10201373 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300014166|Ga0134079_10394913 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300015241|Ga0137418_10660901 | Not Available | 809 | Open in IMG/M |
| 3300015356|Ga0134073_10025201 | All Organisms → cellular organisms → Bacteria | 1458 | Open in IMG/M |
| 3300017659|Ga0134083_10010507 | All Organisms → cellular organisms → Bacteria | 3095 | Open in IMG/M |
| 3300018431|Ga0066655_10117177 | All Organisms → cellular organisms → Bacteria | 1523 | Open in IMG/M |
| 3300018431|Ga0066655_10185564 | All Organisms → cellular organisms → Bacteria | 1272 | Open in IMG/M |
| 3300018431|Ga0066655_10729781 | Not Available | 671 | Open in IMG/M |
| 3300018433|Ga0066667_10119303 | All Organisms → cellular organisms → Bacteria | 1799 | Open in IMG/M |
| 3300018433|Ga0066667_10341888 | Not Available | 1185 | Open in IMG/M |
| 3300018433|Ga0066667_10588459 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300018433|Ga0066667_11062495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 700 | Open in IMG/M |
| 3300018468|Ga0066662_10372537 | Not Available | 1240 | Open in IMG/M |
| 3300018468|Ga0066662_11488214 | Not Available | 704 | Open in IMG/M |
| 3300018468|Ga0066662_12934906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 506 | Open in IMG/M |
| 3300019888|Ga0193751_1012231 | All Organisms → cellular organisms → Bacteria | 4479 | Open in IMG/M |
| 3300020008|Ga0193757_1021849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 640 | Open in IMG/M |
| 3300020579|Ga0210407_10296873 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
| 3300021046|Ga0215015_10098040 | All Organisms → cellular organisms → Bacteria | 1606 | Open in IMG/M |
| 3300021046|Ga0215015_10228939 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
| 3300021046|Ga0215015_10798133 | Not Available | 740 | Open in IMG/M |
| 3300021046|Ga0215015_10860572 | All Organisms → cellular organisms → Bacteria | 2502 | Open in IMG/M |
| 3300021418|Ga0193695_1036970 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
| 3300021432|Ga0210384_10862523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 805 | Open in IMG/M |
| 3300022557|Ga0212123_10010698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 12838 | Open in IMG/M |
| 3300022557|Ga0212123_10015384 | All Organisms → cellular organisms → Bacteria | 9550 | Open in IMG/M |
| 3300022557|Ga0212123_10099918 | All Organisms → cellular organisms → Bacteria | 2372 | Open in IMG/M |
| 3300025910|Ga0207684_10000007 | All Organisms → cellular organisms → Bacteria | 612969 | Open in IMG/M |
| 3300025910|Ga0207684_10015384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 6586 | Open in IMG/M |
| 3300025910|Ga0207684_10424151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1143 | Open in IMG/M |
| 3300025922|Ga0207646_10000059 | All Organisms → cellular organisms → Bacteria | 154875 | Open in IMG/M |
| 3300025922|Ga0207646_10115378 | All Organisms → cellular organisms → Bacteria | 2412 | Open in IMG/M |
| 3300025929|Ga0207664_10396622 | Not Available | 1227 | Open in IMG/M |
| 3300025939|Ga0207665_10107730 | All Organisms → cellular organisms → Bacteria | 1954 | Open in IMG/M |
| 3300026295|Ga0209234_1017734 | All Organisms → cellular organisms → Bacteria | 2693 | Open in IMG/M |
| 3300026295|Ga0209234_1262280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 559 | Open in IMG/M |
| 3300026296|Ga0209235_1071454 | All Organisms → cellular organisms → Bacteria | 1580 | Open in IMG/M |
| 3300026296|Ga0209235_1090596 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
| 3300026297|Ga0209237_1016654 | All Organisms → cellular organisms → Bacteria | 4277 | Open in IMG/M |
| 3300026298|Ga0209236_1032855 | All Organisms → cellular organisms → Bacteria | 2754 | Open in IMG/M |
| 3300026298|Ga0209236_1312091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 508 | Open in IMG/M |
| 3300026300|Ga0209027_1013303 | All Organisms → cellular organisms → Bacteria | 3113 | Open in IMG/M |
| 3300026300|Ga0209027_1091131 | All Organisms → cellular organisms → Bacteria | 1106 | Open in IMG/M |
| 3300026305|Ga0209688_1049424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 793 | Open in IMG/M |
| 3300026309|Ga0209055_1262505 | Not Available | 536 | Open in IMG/M |
| 3300026310|Ga0209239_1056369 | All Organisms → cellular organisms → Bacteria | 1754 | Open in IMG/M |
| 3300026310|Ga0209239_1074074 | All Organisms → cellular organisms → Bacteria | 1482 | Open in IMG/M |
| 3300026315|Ga0209686_1005186 | All Organisms → cellular organisms → Bacteria | 5775 | Open in IMG/M |
| 3300026316|Ga0209155_1197449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 636 | Open in IMG/M |
| 3300026317|Ga0209154_1197081 | Not Available | 779 | Open in IMG/M |
| 3300026318|Ga0209471_1018062 | All Organisms → cellular organisms → Bacteria | 3587 | Open in IMG/M |
| 3300026318|Ga0209471_1018584 | All Organisms → cellular organisms → Bacteria | 3528 | Open in IMG/M |
| 3300026318|Ga0209471_1184457 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300026322|Ga0209687_1057910 | All Organisms → cellular organisms → Bacteria | 1257 | Open in IMG/M |
| 3300026322|Ga0209687_1080021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1064 | Open in IMG/M |
| 3300026324|Ga0209470_1154771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1004 | Open in IMG/M |
| 3300026326|Ga0209801_1020684 | All Organisms → cellular organisms → Bacteria | 3232 | Open in IMG/M |
| 3300026326|Ga0209801_1038388 | Not Available | 2232 | Open in IMG/M |
| 3300026327|Ga0209266_1082177 | Not Available | 1461 | Open in IMG/M |
| 3300026330|Ga0209473_1140743 | Not Available | 987 | Open in IMG/M |
| 3300026371|Ga0257179_1017235 | Not Available | 813 | Open in IMG/M |
| 3300026499|Ga0257181_1040339 | Not Available | 756 | Open in IMG/M |
| 3300026524|Ga0209690_1016448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3817 | Open in IMG/M |
| 3300026528|Ga0209378_1254691 | Not Available | 557 | Open in IMG/M |
| 3300026529|Ga0209806_1066869 | All Organisms → cellular organisms → Bacteria | 1629 | Open in IMG/M |
| 3300026530|Ga0209807_1024666 | All Organisms → cellular organisms → Bacteria | 2915 | Open in IMG/M |
| 3300026530|Ga0209807_1040150 | All Organisms → cellular organisms → Bacteria | 2207 | Open in IMG/M |
| 3300026542|Ga0209805_1247563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 705 | Open in IMG/M |
| 3300026548|Ga0209161_10223396 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300026550|Ga0209474_10706788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 522 | Open in IMG/M |
| 3300026551|Ga0209648_10074278 | All Organisms → cellular organisms → Bacteria | 2854 | Open in IMG/M |
| 3300026552|Ga0209577_10603842 | Not Available | 657 | Open in IMG/M |
| 3300027388|Ga0208995_1004316 | All Organisms → cellular organisms → Bacteria | 2333 | Open in IMG/M |
| 3300027521|Ga0209524_1032498 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300027521|Ga0209524_1043129 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300027521|Ga0209524_1103058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 598 | Open in IMG/M |
| 3300027546|Ga0208984_1136033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 528 | Open in IMG/M |
| 3300027565|Ga0209219_1018288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1699 | Open in IMG/M |
| 3300027587|Ga0209220_1000846 | All Organisms → cellular organisms → Bacteria | 9053 | Open in IMG/M |
| 3300027587|Ga0209220_1006747 | All Organisms → cellular organisms → Bacteria | 3063 | Open in IMG/M |
| 3300027587|Ga0209220_1009977 | All Organisms → cellular organisms → Bacteria | 2530 | Open in IMG/M |
| 3300027587|Ga0209220_1142355 | Not Available | 622 | Open in IMG/M |
| 3300027603|Ga0209331_1052205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1033 | Open in IMG/M |
| 3300027603|Ga0209331_1121362 | Not Available | 631 | Open in IMG/M |
| 3300027610|Ga0209528_1058987 | Not Available | 850 | Open in IMG/M |
| 3300027616|Ga0209106_1045723 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
| 3300027633|Ga0208988_1032923 | All Organisms → cellular organisms → Bacteria | 1335 | Open in IMG/M |
| 3300027645|Ga0209117_1008044 | All Organisms → cellular organisms → Bacteria | 3589 | Open in IMG/M |
| 3300027651|Ga0209217_1084226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 921 | Open in IMG/M |
| 3300027651|Ga0209217_1179237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 577 | Open in IMG/M |
| 3300027674|Ga0209118_1078311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 947 | Open in IMG/M |
| 3300027678|Ga0209011_1034387 | All Organisms → cellular organisms → Bacteria | 1597 | Open in IMG/M |
| 3300027681|Ga0208991_1099285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 873 | Open in IMG/M |
| 3300027727|Ga0209328_10124099 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300027842|Ga0209580_10143388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1173 | Open in IMG/M |
| 3300027846|Ga0209180_10160503 | All Organisms → cellular organisms → Bacteria | 1296 | Open in IMG/M |
| 3300027846|Ga0209180_10640579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 583 | Open in IMG/M |
| 3300027875|Ga0209283_10714111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 625 | Open in IMG/M |
| 3300027882|Ga0209590_10019333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3405 | Open in IMG/M |
| 3300028536|Ga0137415_10779241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 767 | Open in IMG/M |
| 3300028673|Ga0257175_1066302 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300031753|Ga0307477_10158589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1577 | Open in IMG/M |
| 3300031962|Ga0307479_10033935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 4871 | Open in IMG/M |
| 3300032180|Ga0307471_103503875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 555 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 26.70% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 16.74% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 13.57% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.76% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 10.41% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.62% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 2.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.26% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.26% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.36% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.81% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.91% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001086 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 | Environmental | Open in IMG/M |
| 3300001089 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 | Environmental | Open in IMG/M |
| 3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
| 3300001160 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 | Environmental | Open in IMG/M |
| 3300001182 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 | Environmental | Open in IMG/M |
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009400 | Soil microbial community of the Robinson Ridge, Antarctica. Combined Assembly of Gp0139162, Gp0138857, Gp0138858 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011994 | Permafrost microbial communities from Nunavut, Canada - A7_65cm_12M | Environmental | Open in IMG/M |
| 3300011996 | Permafrost microbial communities from Nunavut, Canada - A39_65cm_12M | Environmental | Open in IMG/M |
| 3300011998 | Permafrost microbial communities from Nunavut, Canada - A30_35cm_6M | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012382 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012389 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012400 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020008 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021418 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2 | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026371 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-B | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027388 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12709J13192_10052304 | 3300001086 | Forest Soil | MSKIFLIIALICFILEALGNRVGFKSPVGLLGAGLAFWVASALVG* |
| JGI12709J13192_10133801 | 3300001086 | Forest Soil | MSKILLIIALICFILDAIAGRMKFKAPFGLLPGGLAFWVASQLF* |
| JGI12683J13190_10074671 | 3300001089 | Forest Soil | MTLSKILLIIALICFILDAIAGRMKFKAPFGLLPGGLAFWVASQLF* |
| JGI12636J13339_10421561 | 3300001154 | Forest Soil | LIIALICFILDAVAGRTKFKAPFGLLPGGLAFWVASILF* |
| JGI12654J13325_10056453 | 3300001160 | Forest Soil | MTLSKILLIIALICFILDAIAGRMKFKAPFGLLPGGLAFWVASQVF* |
| JGI12654J13325_10078813 | 3300001160 | Forest Soil | SHMSLSKILLIIALICFILDAIAGRMKFKAPFGLLPGGLAFWVASQLF* |
| JGI12654J13325_10127722 | 3300001160 | Forest Soil | LSLSKILLIIALICFILDAIAGRMKFKAPFGLLPGGLAFWVASQLF* |
| JGI12668J13544_10095942 | 3300001182 | Forest Soil | MSLSKILLIIALICFILEALGSRTGFKSPVGLLGAGLAFFTASFLF* |
| JGI12630J15595_100012148 | 3300001545 | Forest Soil | MSLSKLFLIVALICFILEALASRIKMRAPFGLMGAGLAFLTASYLF* |
| JGI12635J15846_102346791 | 3300001593 | Forest Soil | MTLSKLFLIVALICFILEALGSRIKMRAPFGLLGAGLAFLTASYLF* |
| JGI12635J15846_103318113 | 3300001593 | Forest Soil | MSLSKILLIAALICFILDAIAGRMKFKAPFGLLPGGLAFWVASQLF* |
| JGI12053J15887_1000175710 | 3300001661 | Forest Soil | MSLKTILLIIALICFVVDALGSRMKMRAPFGLLPGGLAFLTAYFLF* |
| JGI12053J15887_103955082 | 3300001661 | Forest Soil | MSLKTILLIIALICFVVDALGSRTKMRAPFGLLPGGLAFLTAAFLF* |
| JGIcombinedJ26739_1009910683 | 3300002245 | Forest Soil | MSLSKILLIIALICFILDAIAGRMKFKAPFGLLPGGLAFWVASQLF* |
| JGI25381J37097_10066812 | 3300002557 | Grasslands Soil | MSLSKIFLIIALICFILDALAGRMKFRAPFGLLAGGLAFLTASQLF* |
| JGI25383J37093_101320122 | 3300002560 | Grasslands Soil | MSLSKILLIIALVCFILDALAGRMKFRAPFSLLPGGLAFLSASFLF* |
| JGI25384J37096_102334451 | 3300002561 | Grasslands Soil | MSLSKILLIIALICFILDALAGRMKFRAPFSLLPGGLAFLTASYLF* |
| JGI25382J37095_100884074 | 3300002562 | Grasslands Soil | MSLSKIFLIVALICFILDALAGRMKFRAPFGLLPGGLAFLAASQLF* |
| JGI25382J37095_100891133 | 3300002562 | Grasslands Soil | MSLSKILLIIALVCFILDALAGRTKFRAPFSLLPGGLAFLTASYLF* |
| JGI25390J43892_101269302 | 3300002911 | Grasslands Soil | MSLSKILLIVALICFILDAVAGRMKFRAPFGLLPGGLAFLTASYLF* |
| JGI25617J43924_102406261 | 3300002914 | Grasslands Soil | MSLSKLFLIAALICFVLEALSGRMKMRAPFSLLGGGLAFWVASILF* |
| Ga0066672_100091744 | 3300005167 | Soil | MSLKTILLIIALICFIIDALGSRMKFRAPFGLLPGGLAFLTASFLF* |
| Ga0066672_100651801 | 3300005167 | Soil | MSLSKIFLIIALICFILDALAGRMKFRAPFGLLAGGLAFLTASQ |
| Ga0066672_107686502 | 3300005167 | Soil | MSLSKIFLIVALICFILDALAGRMKFRAPFGLLPGGLAFLTASLLF* |
| Ga0066672_109471461 | 3300005167 | Soil | VSLKTILLIIALICFILDALGSRMKFRAPFGLLAGGLAFLTASFLF* |
| Ga0066677_100014068 | 3300005171 | Soil | MSLSKIFLIVALICFILDALAGRMKFRAPFGLLPGGLAFLTASFLF* |
| Ga0066677_100656244 | 3300005171 | Soil | MSLSKILLIIALICFILDAVAGRMKFRAPFGLLPGGLAFLTASYLF* |
| Ga0066683_101373263 | 3300005172 | Soil | MSLSKILLIIALICFILDALAGRMKFRAPFSLLPAGLAFLTASYLF* |
| Ga0066680_100229323 | 3300005174 | Soil | VSLKTIFLIIALICFVIDALAGRMKFRAPFGLLPGGLAFLTASFLF* |
| Ga0066673_100642122 | 3300005175 | Soil | MSLSKIFLIIALICFILDALAGRMKFRAPFGLLPGGLAFLAASFLF* |
| Ga0066679_104897922 | 3300005176 | Soil | MSLSKLFLIAALICFVLEALGSRMKMRAPFGLLGAGLAFLTAAQLF* |
| Ga0066679_109573451 | 3300005176 | Soil | MSLKTILLIIALICFILEALGSRIKMRAPFGLLGAGLAFLTASQLF* |
| Ga0066690_101990531 | 3300005177 | Soil | MSLSKILLIIALICFILDALAGRMKFRAPFSLLPAGLAFWLASLLF* |
| Ga0066688_101140442 | 3300005178 | Soil | MSLSKIFLIVALICFILDALAGRLKFRAPFSLLPGGLAFLTAAQLF* |
| Ga0066688_103498712 | 3300005178 | Soil | VSLKTILLIIALICFIVDALGSRMKFRAPFGLLAGGLAFLTASFLF* |
| Ga0066684_101482772 | 3300005179 | Soil | MSLSKLFLIVALICFILEALGSRIKMRAPFGLLGAGLAFLTASYLFA* |
| Ga0066684_102344332 | 3300005179 | Soil | MPIRTILLIVAVILFLLEAFGSRMRFRAPFGMLGAGLACLAAAFLF* |
| Ga0066684_102698723 | 3300005179 | Soil | MSLSKILLIVALICFILDAVAGRMKFRAPFSLLPGGLAFLTASYLF* |
| Ga0066678_101173691 | 3300005181 | Soil | MSLSKILVIIALVCFILDALAGRMKFRAPFGLLPGGLAFLTAS |
| Ga0066671_104464771 | 3300005184 | Soil | MPIRTILLIVAVILFLLEALGSRMRFRAPFGMLGAGLACLAAAFLF* |
| Ga0070709_102448472 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | LSLSKIFLILALICFILEALGSRMKIKLGFGLLGAGLAFLTASYLF* |
| Ga0070709_103089232 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLSKLFLIVALICFILEALGSRIKMRAPFGLLGAGLAFLTASYLF* |
| Ga0070714_1008990932 | 3300005435 | Agricultural Soil | MSLSKLFLIVALICFILEALGNRVGFKSPVGLLGAGLAFWVASALIG* |
| Ga0070705_1012880712 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLSKLFLIVALICFILEALGNRVGFKSPVGLLGAGLAFWVASLLF* |
| Ga0070708_1000146759 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLSKILLILALICFILEALSGRIKMKFGFGLLAAGLAFLTASYLF* |
| Ga0070708_1000200742 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLSKIFLILALICFILEALGSRIKIKLGFGLLGAGLAFLTASYLV* |
| Ga0070708_1002783481 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLSKLFLIVALICFILEALGKRVPFKSPVGLLGAGLAFWVASQLL* |
| Ga0066686_102154814 | 3300005446 | Soil | MSLSKIFLIIALICFILDALAGRMKFRAPFGLLPGGLAFLAASQLF* |
| Ga0066689_107943412 | 3300005447 | Soil | MSLSKILLIVALICFILDAVAGRMKFRAPFGLLPGGLAFLT |
| Ga0066687_100004722 | 3300005454 | Soil | MSIKTILLIIALICFIVDALGSRMKFRAPFGLLAGGLAFLTASFLF* |
| Ga0066687_100162201 | 3300005454 | Soil | KIFLIIALICFILDALAGRMKFRAPFGLLAGGLAFLTASQLF* |
| Ga0066687_100585362 | 3300005454 | Soil | MSLHTLLLIIALICFILEALGSRMRFRAPFGLLGAGLAFLTAAFLFP* |
| Ga0070706_1001137451 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLSKIFLILALICFILDALSGRIKMKFGFGLLGAGLAFLTASYLF* |
| Ga0070707_1000044693 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLSKLFLIVALICFILEALGSRIKIKLGFGLLGAGLAFLTASYLF* |
| Ga0070707_1003839351 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLSKLFLIVALICFILEALGSRIKMRAPFGLLGAGLAFLTASQLF* |
| Ga0070707_1009525263 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLSKIFLILALICFILEALGSRMKIKLGFGLLGAGLAFLTASYLF* |
| Ga0070698_10000210822 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLSKILLILALICFILDALAGRMKFRAPFGLLPAGLAFWVASLLF* |
| Ga0070698_1001310991 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLSKIFLILALICFILEALSGRIKMKFGFGLLGAGLAFLTASYLF* |
| Ga0070699_1002420531 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLSKIFLIVALICFIIDALAGRMKFKAPFSLLPGGLAFLTASYLF* |
| Ga0070697_1002343214 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | LSKLFLIVALICFILEALGSRIKMRAPFGLLGAGLAFLTASYLF* |
| Ga0070697_1005462262 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLKTILLIVALICFIIDALGSRMKFRAPFGLLPGGLAFLTAYFLF* |
| Ga0070732_104340192 | 3300005542 | Surface Soil | MSLHTLLLIIALICFILEALGSRMRFKAPFGLLGAGLAFLTAAFLF* |
| Ga0066692_106225293 | 3300005555 | Soil | FMSLSKIFLIVALICFILDALAGRLKFRAPFSLLPGGLAFLTAAQLF* |
| Ga0066704_101924552 | 3300005557 | Soil | MSLSKILVIIALICFILDALAGRMKFRAPFGLLPGGLAFLAASYLF* |
| Ga0066700_100170041 | 3300005559 | Soil | MSLKTIFLIIALICFILDALGSRMKMRPPFGLLPGGLAFLTAGFLF* |
| Ga0066700_106340211 | 3300005559 | Soil | ICFILDALAGRMKFRAPFGLLPGGLAFLAASQLF* |
| Ga0066700_108269652 | 3300005559 | Soil | MSLSKILLIIALICFILDALAGRMKFRAPFGLLPGGLAFLAASYLF* |
| Ga0066699_100719022 | 3300005561 | Soil | MPIRTILLIVAVILFLLEALGSRMRFRAPFGMLGAGLACFAAAFLF* |
| Ga0066699_101370774 | 3300005561 | Soil | MSLSKILLIIALICFILDAVAGRMKFRAPFSLLPGGLAFLTASYLF* |
| Ga0066699_105892852 | 3300005561 | Soil | MSLSKILLIIALICFILDALAGRMKFRAPFSLLPAGLAFWVASLLF* |
| Ga0066703_100156595 | 3300005568 | Soil | MSLSKILLIIALICFILDAIAGRMKFRAPFSLLPGGLAFLTASYLF* |
| Ga0066703_105008741 | 3300005568 | Soil | ANFVWRLFMSLSKLFLIAALICFVLEALGSRMKMRAPFGLLGGGLAFLTAAQLF* |
| Ga0066702_101525482 | 3300005575 | Soil | MSLKTILLIIALICFIVDALGSRMKFRAPFGLLAGGLAFLTASFLF* |
| Ga0066691_104177142 | 3300005586 | Soil | MSLSKILVIIALICFILDALAGRMKFRAPFSLLPAGLAFLTASYLF* |
| Ga0066654_106039421 | 3300005587 | Soil | IIALICFILDALAGRMKFRAPFGLLPGGLAFLAASFLF* |
| Ga0070717_102874414 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLSKIFLILALICFILEALGSRVKIKLGFGLLGAGLAFLTASYLV* |
| Ga0066651_108184851 | 3300006031 | Soil | IVALICFILDAVAGRMKFRAPFSLLPGGLAFLTASYLF* |
| Ga0066696_100130331 | 3300006032 | Soil | YRRWLMSIKTILLIIALICFIVDALGSRMKFRAPFGLLAGGLAFLTASFLF* |
| Ga0066696_109510092 | 3300006032 | Soil | IIALICFILDALAGRMKFRAPFGLLAGGLAFLTASQLF* |
| Ga0070716_1008198892 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLKTILLIVALICFIIDALGSRLKFRAPFGLLPGGLAFLTASFLF* |
| Ga0099794_104504161 | 3300007265 | Vadose Zone Soil | MSPILFGGVHLSLSKILLIIALICFILDAVAGRTKFKAPFSLLPGGLAFWVASLLF* |
| Ga0102924_10009282 | 3300007982 | Iron-Sulfur Acid Spring | MSLSKLFLLIALICFILEAIGSRMSFKAPFGLLGAGLAFLTAAFLFP* |
| Ga0102924_10664682 | 3300007982 | Iron-Sulfur Acid Spring | MSLSKLLLVIALICFILEAIGSRMSFKAPFGLLGAGLAFLTAAFLFP* |
| Ga0066710_1000226965 | 3300009012 | Grasslands Soil | MSLSKIFLIVALICFILDALAGRLKFRAPCSLLPGGLAFLTAAQLF |
| Ga0099829_102765344 | 3300009038 | Vadose Zone Soil | MSLPKILQIIALICFILDAVAGRTKFKAPFSLLPGGLAFWVASLLF* |
| Ga0099829_103250063 | 3300009038 | Vadose Zone Soil | LSLSKILLIIALICFILEALSGRMKMKFGFGLLGAGLAFLTASYLF* |
| Ga0099830_109921221 | 3300009088 | Vadose Zone Soil | MSLSKILLIIALICFILDAVAGRTKFKAPFSLLPGGLAFWVASLLF* |
| Ga0099830_115734021 | 3300009088 | Vadose Zone Soil | MSLSKILLIIALICFILEALSGRIKMKFGFGLLGAGLAFWVASQLF* |
| Ga0099828_115661331 | 3300009089 | Vadose Zone Soil | APSFFGRSYMSLSKILLIIALICFILDALAGRMKFRAPFSLLPAGLAFWVASILF* |
| Ga0099827_1000009814 | 3300009090 | Vadose Zone Soil | LSLSKILLIIALICFILEALSGRIKMKFGFGLLGAGLAFLTASFLF* |
| Ga0099792_110244011 | 3300009143 | Vadose Zone Soil | MSLSKLFLIVALICFILEALGSRIKMRAPFGLLGAGLAFLTA |
| Ga0116854_11418742 | 3300009400 | Soil | MSLHTLFLIIALICFVLEALGSRMSFKAPFGLLGAGLAFLTAAFLF* |
| Ga0134084_100110095 | 3300010322 | Grasslands Soil | IIALGCFILDALAGRMKFRAPFSLLPGGLAFLSASFLF* |
| Ga0134084_102232001 | 3300010322 | Grasslands Soil | MSLSKIFLIIALICFILDALAGRMKFRAPFGLLPGGLAFLAASQL |
| Ga0134086_100523031 | 3300010323 | Grasslands Soil | MSLSKILLIVALICFILDAVAGRMKFRAPFGLLPGGLAF |
| Ga0134064_103851601 | 3300010325 | Grasslands Soil | MSLSKILLIIALICFILDALAGRMKFRAPFSLLPAGLA |
| Ga0150983_101635631 | 3300011120 | Forest Soil | MSLSKILLIIALICFILEALSGRIKMKFGFGLLGAGLAFLTASYLF* |
| Ga0137391_109906031 | 3300011270 | Vadose Zone Soil | LSLSKILLIIALICFILEALSGRIKMKFGFGLLGAGLAFLTASYLF* |
| Ga0120157_11115491 | 3300011994 | Permafrost | MSLHTLLLIVALICFILEALGSRMKFRAPFGLLGAGLAFLTAAFLF* |
| Ga0120156_10454362 | 3300011996 | Permafrost | MSLSKLFLIVALICFILEALGSRMKFRSPFGLLGAGLAFLTASFLF* |
| Ga0120114_10069915 | 3300011998 | Permafrost | MSLHTLFLIIALICFVIEALGSRMSFKAPFGLLGAGLAFLTAAFLF* |
| Ga0137364_105711422 | 3300012198 | Vadose Zone Soil | MSLSKILLIIALVCFILDAIAGRMKFRAPFSLLPGGLAFLTASYLF* |
| Ga0137382_105927461 | 3300012200 | Vadose Zone Soil | MSLSKILLIIALICFILDAVAGRMKFRAPFGLLPGGL |
| Ga0137399_100333915 | 3300012203 | Vadose Zone Soil | MSLSKIFLIIALICFVIDALAGRMKFRAPFGLLPGGLAFLTASYLF* |
| Ga0137376_103509162 | 3300012208 | Vadose Zone Soil | MSLSKILLIVALVCFILDAVAGRMKFRAPFGLLPGGLAFLTASYLF* |
| Ga0137376_104240831 | 3300012208 | Vadose Zone Soil | MSLKTILLIVALICFIVDALGSRMKFRAPFGLLPGGLAFLTASFLF* |
| Ga0137376_116569082 | 3300012208 | Vadose Zone Soil | VALKTIFLIIALICFIVDALGSRMKFRAPFGLLPGGLAFLTASYLF* |
| Ga0137379_104266684 | 3300012209 | Vadose Zone Soil | MSLSKILVIIALVCFVLDALAGRLKFRAPFGLLPGGLAFLTASFLF* |
| Ga0137371_112767491 | 3300012356 | Vadose Zone Soil | MSLSKIFLIIALICFILDALAGRMKFRAPFGLLPGGLAF |
| Ga0137390_119618291 | 3300012363 | Vadose Zone Soil | LSLPKILLIIALICFILEALSGRMKMKFGFGLLGAGLAFLTASYLF* |
| Ga0134038_12700544 | 3300012382 | Grasslands Soil | LLIIALICFILDAVAGRMKFRAPFGLLPGGLAFLTASYLF* |
| Ga0134040_10506814 | 3300012389 | Grasslands Soil | SSMSLSKIFLIVALICFILDAVAGRMKFRAPFSLLPGGLAFLTASYLF* |
| Ga0134048_13680914 | 3300012400 | Grasslands Soil | SLSKILLIIALVCFILDALAGRMKFRAPFSLLPGGLAFLSASFLF* |
| Ga0137398_101276971 | 3300012683 | Vadose Zone Soil | MSLSKILLIIALACFVLDAVAGRMKFRAPFSLLPGGLAFLTASYLF* |
| Ga0137396_105339582 | 3300012918 | Vadose Zone Soil | MSLKTILLIIALICFILDALGSRMKMRPPFGLLPGGLAFLTAAFLF* |
| Ga0120158_105355681 | 3300013772 | Permafrost | MSLSKLFLIVALICFILEALGSRMKFRSPFGLLGAG |
| Ga0134081_100382491 | 3300014150 | Grasslands Soil | LICFILDALAGRMKFRAPFGLLPGGLAFLAASQSF* |
| Ga0134078_102013733 | 3300014157 | Grasslands Soil | FLIIALICFILDALAGRMKFRAPFGLLPGGLAFLAASQLF* |
| Ga0134079_103949133 | 3300014166 | Grasslands Soil | EVESMSLSKIFLIIALICFILDALAGRMKFRAPFGLLAGGLAFLTASQLF* |
| Ga0137418_106609011 | 3300015241 | Vadose Zone Soil | MSLSKIFLIIALICFVIDALAGRMEFRAPFGLLPGGLAFLTASYLF* |
| Ga0134073_100252011 | 3300015356 | Grasslands Soil | MSLSKILLIVALICFILDAVAGRMKFRAPFGLLPGGLAFLTASFLF* |
| Ga0134083_100105071 | 3300017659 | Grasslands Soil | VSLKTIFLIIALICFIVDALGSRMKFRAPFGLLPGGLAFLTASYLF |
| Ga0066655_101171774 | 3300018431 | Grasslands Soil | MSLSKIFLIIALICFILDALAGRMKFRAPFGLLAGGLAFLTASQLF |
| Ga0066655_101855642 | 3300018431 | Grasslands Soil | MSLSKILLIVALICFILDAVAGRMKFRAPFGLLPGGLAFLTASYLF |
| Ga0066655_107297812 | 3300018431 | Grasslands Soil | MSLSKIFLIIALICFILDALAGRMKFRAPFGLLPGGLAFLAASQLF |
| Ga0066667_101193032 | 3300018433 | Grasslands Soil | MSLSKILLIIALICFILDAVAGRMKFRAPFGLLPGGLAFLTASYLF |
| Ga0066667_103418881 | 3300018433 | Grasslands Soil | MSLKTILLIIALICFIIDALGSRMKFRAPFGLLPGGLAFLTASFLF |
| Ga0066667_105884591 | 3300018433 | Grasslands Soil | MSLSKIFLIVALICFILDALAGRLKFRAPFSLLPGGLAFLTAAQLF |
| Ga0066667_110624951 | 3300018433 | Grasslands Soil | LVSLKTIFLIIALICFVIDALAGRMKFRAPFGLLPGGLAFLTASFLF |
| Ga0066662_103725372 | 3300018468 | Grasslands Soil | MSIKTILLIIALICFIVDALGSRMKFRAPFGLLAGGLAFLTASFLF |
| Ga0066662_114882141 | 3300018468 | Grasslands Soil | MSLSKILLIIALICFILDALAGRMKFRAPFSLLPGGLAFLAASYLF |
| Ga0066662_129349061 | 3300018468 | Grasslands Soil | MSLHSLLLIIALICFILEALGSRMRFRAPFGLLGAGLAFLTAAFLF |
| Ga0193751_10122314 | 3300019888 | Soil | MSLSKLFLIVALICFILEALGNRVGFKSPVGLLGAGLAFWVASLLF |
| Ga0193757_10218491 | 3300020008 | Soil | MSLSKIFLIIALICFVLEALGNRTGFKSPFGLMGAGLAFLTASFLF |
| Ga0210407_102968734 | 3300020579 | Soil | MSLSKILLIIALICFILEALSGRIKMKFGFGLLGAGLAFLTASYLF |
| Ga0215015_100980404 | 3300021046 | Soil | MLKTVLLVIALICFIIDALGSRMKFRAPFGLLPGGLAFLTAYFLF |
| Ga0215015_102289394 | 3300021046 | Soil | LSLSKILLIIALICFILEALSGRIKMKFGFGLLGAGLAFLTASYLF |
| Ga0215015_107981331 | 3300021046 | Soil | MSLSKIFLIIALICFILEALSGRVKMRFGFGLLGAGLAFWVASQLF |
| Ga0215015_108605724 | 3300021046 | Soil | MHQILLIIALICFIVDALASRMKFRAPFGLLPGGLAFLTASYLL |
| Ga0193695_10369703 | 3300021418 | Soil | MSLSKLFLIIALICFILEALGNRVGFKSPFGLMGAGLAFLTASFLF |
| Ga0210384_108625232 | 3300021432 | Soil | MSLSKIFLILALICFILEALGSRMKIKLGFGLLGAGLAFLTASYLF |
| Ga0212123_100106987 | 3300022557 | Iron-Sulfur Acid Spring | MSLSKLLLVIALICFILEAIGSRMSFKAPFGLLGAGLAFLTAAFLFP |
| Ga0212123_100153842 | 3300022557 | Iron-Sulfur Acid Spring | MSLSKLFLLIALICFILEAIGSRMSFKAPFGLLGAGLAFLTAAFLFP |
| Ga0212123_100999181 | 3300022557 | Iron-Sulfur Acid Spring | MSKIFLIIALICFILEALGNRVGFKSPVGLLGAGLAFWVASALVG |
| Ga0207684_10000007348 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLSKILLILALICFILEALSGRIKMKFGFGLLAAGLAFLTASYLF |
| Ga0207684_100153844 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLSKIFLILALICFILDALSGRIKMKFGFGLLGAGLAFLTASYLF |
| Ga0207684_104241511 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLSKIFLILALICFILEALGSRIKIKLGFGLLGAGLAFLTASYLV |
| Ga0207646_10000059103 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLSKLFLIVALICFILEALGSRIKIKLGFGLLGAGLAFLTASYLF |
| Ga0207646_101153782 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLSKLFLIVALICFILEALGSRIKMRAPFGLLGAGLAFLTASQLF |
| Ga0207664_103966222 | 3300025929 | Agricultural Soil | MSLSKLFLIVALICFILEALGNRVGFKSPVGLLGAGLAFWVASALIG |
| Ga0207665_101077304 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLSKIFLIVALICFIIDALAGRMKFKAPFSLLPGGLAFLTASYLF |
| Ga0209234_10177345 | 3300026295 | Grasslands Soil | MPIRTILLIVAVILFLLEALGSRMRFRAPFGMLGAGLACFAAAFLF |
| Ga0209234_12622801 | 3300026295 | Grasslands Soil | MSLKTILLIIALVCFIVDALGSRMKFRAPFGLLAGGLAFLTASFLF |
| Ga0209235_10714541 | 3300026296 | Grasslands Soil | MSLSKIFLIVALICFILDALAGRMKFRAPFGLLPGGLAFLAASQLF |
| Ga0209235_10905961 | 3300026296 | Grasslands Soil | MSLSKILLIIALICFILDALAGRMKFRAPFSLLPGGLAFLTASYLF |
| Ga0209237_10166542 | 3300026297 | Grasslands Soil | MSLSKILVIIALVCFVLDALAGRMKFRAPFSLLPGGLAFLTASFLF |
| Ga0209236_10328551 | 3300026298 | Grasslands Soil | YDVANFVWRLSMSLSKILLIIALICFILDALAGRMKFRAPFSLLPGGLAFLTASYLF |
| Ga0209236_13120912 | 3300026298 | Grasslands Soil | MSLSKILLIIALVCFILDALAGRMKFRAPFSLLPGGLAFLSASFLF |
| Ga0209027_10133032 | 3300026300 | Grasslands Soil | MSLSKLFLIAALICFVLEALGSRMKMRAPFGLLGAGLAFLTAAQLF |
| Ga0209027_10911311 | 3300026300 | Grasslands Soil | MQMSLSKIFLIIALVCFILDALAGRMKFRAPFGLLPGGLAFLTASMLF |
| Ga0209688_10494242 | 3300026305 | Soil | MSLSKIFLIIALICFILDALAGRMKFRAPFGLLAGGLAFLAASQLF |
| Ga0209055_12625051 | 3300026309 | Soil | MSLSKIFLIIALICFILDALAGRMKFRAPFGLLAG |
| Ga0209239_10563692 | 3300026310 | Grasslands Soil | MSLSKILLIVALICFILDAVAGRMKFRAPFSLLPGGLAFLTASYLF |
| Ga0209239_10740741 | 3300026310 | Grasslands Soil | SKILLIIALVCFILDALAGRMKFRAPFSLLPGGLAFLSASFLF |
| Ga0209686_10051864 | 3300026315 | Soil | MSLSKIFLIVALICFILDALAGRMKFRAPFGLLPGGLAFLTASFLF |
| Ga0209155_11974492 | 3300026316 | Soil | MSLSKIFLIIALICFILDALAGRMKFRAPFGLLPGGLAFLAASFLF |
| Ga0209154_11970812 | 3300026317 | Soil | MSLSKILLIIALICFILDALAGRMKFRAPFGLLPGGLAFLAASYLF |
| Ga0209471_10180622 | 3300026318 | Soil | MSLSKILVIIALICFILDALAGRMKFRAPFGLLPGGLAFLAASYLF |
| Ga0209471_10185844 | 3300026318 | Soil | MSLSKILLIIALICFILDAIAGRMKFRAPFSLLPGGLAFLTASYLF |
| Ga0209471_11844571 | 3300026318 | Soil | LSKLFLIVALICFILEALGSRIKMRAPFGLLGAGLAFLTASYLF |
| Ga0209687_10579103 | 3300026322 | Soil | MSLHTLLLIIALICFILEALGSRMRFRAPFGLLGAGLAFLTAAFLFP |
| Ga0209687_10800212 | 3300026322 | Soil | MSLSKIFLIVALICFILDALAGRMKFRAPFGLLPGGLAFLTASLLF |
| Ga0209470_11547711 | 3300026324 | Soil | MSLSKILLIIALICFILDAVAGRMKFRAPFGLLPGGLAFLTASY |
| Ga0209801_10206844 | 3300026326 | Soil | VSLKTIFLIIALICFVIDALAGRMKFRAPFGLLPGGLAFLTASFLF |
| Ga0209801_10383882 | 3300026326 | Soil | MSLSKILVIIALVCFILDALAGRMKFRAPFGLLPGGLAFLTASFLF |
| Ga0209266_10821772 | 3300026327 | Soil | MSLSKILLIIALICFILDALAGRMKFRAPFSLLPAGLAFLTASYLF |
| Ga0209473_11407431 | 3300026330 | Soil | MPIRTILLIVAVILFLLEAFGSRMRFRAPFGMLGAGLACLAAAFLF |
| Ga0257179_10172352 | 3300026371 | Soil | MSLSKIFLIVALILFILEALSSRIKMKFGFGLLGAGLAFLTASYLF |
| Ga0257181_10403393 | 3300026499 | Soil | LSLSKILLIIALICFILEALSGRVKMKFGFGLLGAGLAFLTASYLF |
| Ga0209690_10164484 | 3300026524 | Soil | MSLSKIFLIIALICFILDALAGRMKFRAPFGLMAGGLAFLTASQLF |
| Ga0209378_12546911 | 3300026528 | Soil | MSLSKILLIIALICFILDAVAGRMKFRAPFSLLPGGLAFLTASYLF |
| Ga0209806_10668691 | 3300026529 | Soil | MSLKTIFLIIALICFILDALGSRMKMRPPFGLLPGGLAFLTAGFLF |
| Ga0209807_10246662 | 3300026530 | Soil | MSIKTILLIIALICFIIDALGSRMKFRAPFGLLPGGLAFLTASFLF |
| Ga0209807_10401501 | 3300026530 | Soil | MSLSKLFLIVALICFILEALGSRIKMRAPFGLLGAGLAFLTASYLFA |
| Ga0209805_12475631 | 3300026542 | Soil | LSTILLIVALICFILDAVAGRMKFRAPFSLLPGGLAFLTASYLF |
| Ga0209161_102233964 | 3300026548 | Soil | LICFILEALGSRIKMRAPFGLLGAGLAFLTASYLFA |
| Ga0209474_107067881 | 3300026550 | Soil | SFMPIRTILLIVAVILFLLEAFGSRMRFRAPFGMLGAGLACLAAAFLF |
| Ga0209648_100742784 | 3300026551 | Grasslands Soil | MSLSKLFLIAALICFVLEALSGRMKMRAPFSLLGGGLAFWVASILF |
| Ga0209577_106038421 | 3300026552 | Soil | MSLSKLFLIVALICFILEALGSRIKMRAPFGLLGAWLAFLT |
| Ga0208995_10043164 | 3300027388 | Forest Soil | MSLKTILLIIALICFVVDALGSRMKMRAPFGLLPGGLAFLTAYFLF |
| Ga0209524_10324983 | 3300027521 | Forest Soil | MTLSKILLIIALICFILDAIAGRMKFKAPFGLLPGGLAFWVASQLF |
| Ga0209524_10431291 | 3300027521 | Forest Soil | MSLSKLFLIVALICFILEALASRIKMRAPFGLMGAGLAFLTASYLF |
| Ga0209524_11030581 | 3300027521 | Forest Soil | MSLSKILLIIALICFILEALGSRTGFKSPVGLLGAGLAFFTASFLF |
| Ga0208984_11360332 | 3300027546 | Forest Soil | MSLKTILLIIALICFVVDALGSRMKMRPPFGLLPGGLAFLTAYFLF |
| Ga0209219_10182884 | 3300027565 | Forest Soil | MSLSKILLIAALICFILDAIAGRMKFKAPFGLLPGGLAFWVASQLF |
| Ga0209220_10008462 | 3300027587 | Forest Soil | MTLSKLFLIVALICFILEALASRIKMRAPFGLLGAGLAFLTASYLF |
| Ga0209220_10067471 | 3300027587 | Forest Soil | MSKILLIIALICFILDAIAGRMKFKAPFGLLPGGLAFWVASQLF |
| Ga0209220_10099773 | 3300027587 | Forest Soil | MSLSKILQIIALICFILDAVSGRMKFRAPFGLLPGGLAFWVASIVF |
| Ga0209220_11423551 | 3300027587 | Forest Soil | MSPSKILLIIALICFILDAIAGRMKFKAPFGLLPGGLAFWVASQLF |
| Ga0209331_10522051 | 3300027603 | Forest Soil | LSLSKILLIIALICFILDAIAGRMKFKAPFGLLPGGLAFWVASQLF |
| Ga0209331_11213621 | 3300027603 | Forest Soil | MSLSKLFLIVALICFILEALASRIKMRAPFGLMGAGLAFLTASYL |
| Ga0209528_10589871 | 3300027610 | Forest Soil | MSLSKIFLILALICFVLEALGSRMKIKLGFGLLGAGLAFLTASYLF |
| Ga0209106_10457231 | 3300027616 | Forest Soil | MSLKTILLIIALICFVVDALGSRTKMRAPFGLLPGGLAFLTAAFLF |
| Ga0208988_10329233 | 3300027633 | Forest Soil | MSLKTILLIIALICFVVDALGSRMKMRAPFGLLPGGLAFLTAAFLF |
| Ga0209117_10080443 | 3300027645 | Forest Soil | MTLSKLFLIVALICFILEALGSRIKMRAPFGLLGAGLAFLTASYLF |
| Ga0209217_10842262 | 3300027651 | Forest Soil | MSLSKIFLIVALICFILDALSSRTKFKAPFGLLPGGLAFWVASLLF |
| Ga0209217_11792371 | 3300027651 | Forest Soil | MTLSKILLIIALICFILDAIAGRMKFKAPFGLLPGGLAFWVASQVF |
| Ga0209118_10783113 | 3300027674 | Forest Soil | MSKILLIIALICFILDAVAGRTKFKAPFGLLPGGLAFWVASILF |
| Ga0209011_10343872 | 3300027678 | Forest Soil | MSLPKILQIIALICFILDAVAGRMKFRAPFGLLPGGLAFWVASLLV |
| Ga0208991_10992853 | 3300027681 | Forest Soil | MSLKTILLIIALICFILDALGSRMKMRPPFGLLPGGLAFLTAAFLF |
| Ga0209328_101240993 | 3300027727 | Forest Soil | MSLSKILLIIALICFILDAIAGRMKFKAPFGLLPGGLAFWVASQLF |
| Ga0209580_101433882 | 3300027842 | Surface Soil | MSLHTLLLIIALICFILEALGSRMRFKAPFGLLGAGLAFLTAAFLF |
| Ga0209180_101605031 | 3300027846 | Vadose Zone Soil | MSLPKILQIIALICFILDAVAGRTKFKAPFSLLPGGLAFWVASLLF |
| Ga0209180_106405791 | 3300027846 | Vadose Zone Soil | LSLSKILLIIALICFILEALSGRMKMKFGFGLLGAGLAFLTASYLF |
| Ga0209283_107141112 | 3300027875 | Vadose Zone Soil | MSLSKILLIIALICFILDAVAGRTKFKAPFSLLPGGLAFWVASLLF |
| Ga0209590_100193335 | 3300027882 | Vadose Zone Soil | LSLSKILLIIALICFILEALSGRIKMKFGFGLLGAGLAFLTASFLF |
| Ga0137415_107792412 | 3300028536 | Vadose Zone Soil | MSLSKLFLIAALICFVLEALGSRMKLRAPFSLLGGGLAFWVASQLF |
| Ga0257175_10663021 | 3300028673 | Soil | APSFFRRSDMSLSKILLIIALICFILDAVAGRTKFKAPFSLLPGGLAFWVASLLF |
| Ga0307477_101585892 | 3300031753 | Hardwood Forest Soil | MSLKTILLIIALICFILDALGSRMKFRAPFGLLPGGLAFLTASFLF |
| Ga0307479_100339355 | 3300031962 | Hardwood Forest Soil | MSLKTILLIIALICFIVDALGSRMKFRAPFGLLPGGLAFLTAYFLF |
| Ga0307471_1035038751 | 3300032180 | Hardwood Forest Soil | FMSLSKLFLIVALICFILEALGSRIKMRAPFGLLGAGLAFLTASYLF |
| ⦗Top⦘ |