Scaffold Ga0214090_10156892

Overview

Basic Information

• Taxon OID: 3300020816
• Scaffold ID: Ga0214090_10156892
• Source Dataset Name: Food waste microbial community from Durham, Ontario, Canada - FW1 megahit
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Toronto
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 552
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioreactor → Aerobic → Unclassified → Unclassified → Food Waste → Metagenomes From Anaerobic Digester Of Solid Waste

Source Dataset Sampling Location

• Location Name: Durham, Ontario, Canada
• Coordinates
  • Lat. (^o): 44.1763
  • Long. (^o): -80.8185

Associated Families

Family	Category	Number of Sequences	3D Structure?
F065766	Metagenome / Metatranscriptome	127	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0214090_101568922	F065766	N/A	MAEENKDKGARDPIKILLDEALEKQRNAMMDNFAQSLQRL