Scaffold Ga0214071_1364374

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0214071_1364374

Scaffold Ga0214071_1364374

Overview

Basic Information
Taxon OID	3300020812 Open in IMG/M
Scaffold ID	Ga0214071_1364374 Open in IMG/M
Source Dataset Name	Anaerobic digester digestate microbial community, University of Toronto, Ontario, Canada - DG074 megahit
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Toronto
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	954
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester Digestate → Metagenomes From Anaerobic Digester Of Solid Waste

Source Dataset Sampling Location
Location Name	University of Toronto, Toronto, Ontario, Canada
Coordinates	Lat. (^o)	43.5479	Long. (^o)	-79.6609	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F064893	Metagenome / Metatranscriptome	128	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0214071_13643742	F064893	AGGAGG	MPKIVRYEFMGSWFYFWLLSITVIGIPLALLYLLSGTLRIGSAMEDPERFVEQFRLRQTS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.