NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0214172_1000125

Scaffold Ga0214172_1000125


Overview

Basic Information
Taxon OID3300020733 Open in IMG/M
Scaffold IDGa0214172_1000125 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Trout Bog Lake, WI - 12JUL2007 epilimnion
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)41958
Total Scaffold Genes65 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)54 (83.08%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameTrout Bog, Vilas County, Wisconsin, USA
CoordinatesLat. (o)46.041Long. (o)-89.686Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F033624Metagenome / Metatranscriptome177Y
F074312Metagenome / Metatranscriptome119Y
F083897Metagenome / Metatranscriptome112Y

Sequences

Protein IDFamilyRBSSequence
Ga0214172_100012535F074312GGTGGMDIERAKQKIEDAKTSVPLNHKDYEWMDGFNHGLDWALRILEGDKSAS
Ga0214172_100012540F033624GAGMSHGDLSFATIEAVARFNFNRAKGNDASQGHAPTWVEQVAREISGCLGEIAIARWQDKFPFALFTERKMGDVGEFEVRTTAYATGKLLITEKDDPARKYLLVTLPTFYTANIHGWMYGYEAQDSKYYNTSMRAPVYAVEQQYLHAPETIYG
Ga0214172_100012555F083897GAGGMSNEIADLRATPGSEADYRSLGPISVCPCGSDLWNVKCKFDDDGELGIYFLDMRCALCDSLAVAPMPKLDE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.