Scaffold Ga0211547_10077883

Overview

Basic Information

• Taxon OID: 3300020474
• Scaffold ID: Ga0211547_10077883
• Source Dataset Name: Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1750
• Total Scaffold Genes: 10
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 9 (90.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_151
• Coordinates
  • Lat. (^o): 36.139
  • Long. (^o): -28.9598
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F053549	Metagenome	141	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211547_100778832	F053549	GGAGG	VKVGDLVKWENVLNDSMDRHCSDYGIVIKMSITGHKTKSAEVLFTDGRTAWFDTQRLVLVNENR