NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F053549

Metagenome Family F053549

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F053549
Family Type Metagenome
Number of Sequences 141
Average Sequence Length 64 residues
Representative Sequence MKVGDLVKWENVLNDSMDHHREDHGIVIKMSRTGHDTESAQVLFTDGETWWLDTQKLEVVNESK
Number of Associated Samples 106
Number of Associated Scaffolds 141

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 76.60 %
% of genes near scaffold ends (potentially truncated) 18.44 %
% of genes from short scaffolds (< 2000 bps) 65.96 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction Yes
3D model pTM-score0.65

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (70.922 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(36.170 % of family members)
Environment Ontology (ENVO) Unclassified
(85.106 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(94.326 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 3.26%    β-sheet: 35.87%    Coil/Unstructured: 60.87%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.65
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 141 Family Scaffolds
PF04434SWIM 2.13
PF14328DUF4385 1.42
PF07728AAA_5 1.42
PF13365Trypsin_2 1.42
PF00462Glutaredoxin 1.42
PF05728UPF0227 0.71
PF13203DUF2201_N 0.71
PF04545Sigma70_r4 0.71
PF00085Thioredoxin 0.71

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 141 Family Scaffolds
COG4279Uncharacterized protein, contains SWIM-type Zn finger domainFunction unknown [S] 2.13
COG4715Uncharacterized protein, contains SWIM-type Zn finger domainFunction unknown [S] 2.13
COG5431Predicted nucleic acid-binding protein, contains SWIM-type Zn-finger domainGeneral function prediction only [R] 2.13

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.74 %
UnclassifiedrootN/A4.26 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001450|JGI24006J15134_10002566All Organisms → cellular organisms → Bacteria → Proteobacteria9930Open in IMG/M
3300001974|GOS2246_10008771All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium1432Open in IMG/M
3300002483|JGI25132J35274_1006745All Organisms → cellular organisms → Bacteria2874Open in IMG/M
3300002483|JGI25132J35274_1008736All Organisms → Viruses → Predicted Viral2517Open in IMG/M
3300002483|JGI25132J35274_1011022All Organisms → Viruses → Predicted Viral2218Open in IMG/M
3300005074|Ga0070431_1037459All Organisms → Viruses → Predicted Viral2601Open in IMG/M
3300005433|Ga0066830_10052027All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium840Open in IMG/M
3300006029|Ga0075466_1003813All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium5436Open in IMG/M
3300006029|Ga0075466_1026955All Organisms → Viruses → Predicted Viral1817Open in IMG/M
3300006165|Ga0075443_10023369All Organisms → Viruses → Predicted Viral2069Open in IMG/M
3300006190|Ga0075446_10137246All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300006752|Ga0098048_1081506All Organisms → cellular organisms → Bacteria988Open in IMG/M
3300006753|Ga0098039_1226773All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium630Open in IMG/M
3300006789|Ga0098054_1023088All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium2468Open in IMG/M
3300006789|Ga0098054_1085963All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1184Open in IMG/M
3300006793|Ga0098055_1094115All Organisms → Viruses → Predicted Viral1173Open in IMG/M
3300006841|Ga0068489_140708All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300006916|Ga0070750_10001997All Organisms → cellular organisms → Bacteria11346Open in IMG/M
3300006924|Ga0098051_1144993All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium628Open in IMG/M
3300006928|Ga0098041_1017339All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium2363Open in IMG/M
3300007229|Ga0075468_10014212All Organisms → Viruses → Predicted Viral3045Open in IMG/M
3300007229|Ga0075468_10066367All Organisms → Viruses → Predicted Viral1192Open in IMG/M
3300007276|Ga0070747_1035569All Organisms → cellular organisms → Bacteria1955Open in IMG/M
3300007276|Ga0070747_1094447All Organisms → Viruses → Predicted Viral1107Open in IMG/M
3300007283|Ga0066366_10278453All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300007510|Ga0105013_1065662All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium2954Open in IMG/M
3300007512|Ga0105016_1125194All Organisms → cellular organisms → Bacteria1422Open in IMG/M
3300007513|Ga0105019_1014589All Organisms → cellular organisms → Bacteria5901Open in IMG/M
3300008219|Ga0114905_1268431All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300008220|Ga0114910_1180363All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300009108|Ga0117920_1008910All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium6356Open in IMG/M
3300009413|Ga0114902_1019861All Organisms → Viruses → Predicted Viral2179Open in IMG/M
3300009420|Ga0114994_10591446All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300009420|Ga0114994_11049415All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300009425|Ga0114997_10304844All Organisms → cellular organisms → Bacteria880Open in IMG/M
3300009425|Ga0114997_10674031All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300009426|Ga0115547_1220375All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300009433|Ga0115545_1061215All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1422Open in IMG/M
3300009435|Ga0115546_1299243All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300009512|Ga0115003_10269436All Organisms → cellular organisms → Bacteria1011Open in IMG/M
3300009593|Ga0115011_10013120All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium5508Open in IMG/M
3300009593|Ga0115011_10323158All Organisms → Viruses → Predicted Viral1179Open in IMG/M
3300010150|Ga0098056_1268002All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300010153|Ga0098059_1065553All Organisms → Viruses → Predicted Viral1452Open in IMG/M
3300010883|Ga0133547_10246736Not Available3754Open in IMG/M
3300010883|Ga0133547_10681615All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium2039Open in IMG/M
3300012928|Ga0163110_10082288All Organisms → cellular organisms → Bacteria2110Open in IMG/M
3300012950|Ga0163108_10002661All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium12860Open in IMG/M
3300012952|Ga0163180_10003532All Organisms → cellular organisms → Bacteria8726Open in IMG/M
3300012953|Ga0163179_10002928Not Available11721Open in IMG/M
3300012953|Ga0163179_11324531All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300012954|Ga0163111_11102885All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300017697|Ga0180120_10194765All Organisms → cellular organisms → Bacteria842Open in IMG/M
3300017705|Ga0181372_1015564All Organisms → Viruses → Predicted Viral1319Open in IMG/M
3300017706|Ga0181377_1056743All Organisms → cellular organisms → Bacteria736Open in IMG/M
3300017709|Ga0181387_1082813All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium650Open in IMG/M
3300017710|Ga0181403_1000427All Organisms → cellular organisms → Bacteria10232Open in IMG/M
3300017713|Ga0181391_1092401All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300017719|Ga0181390_1139482All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300017720|Ga0181383_1019473All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1821Open in IMG/M
3300017720|Ga0181383_1052686All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1093Open in IMG/M
3300017720|Ga0181383_1095793All Organisms → cellular organisms → Bacteria797Open in IMG/M
3300017728|Ga0181419_1022916All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium1741Open in IMG/M
3300017729|Ga0181396_1114562All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300017731|Ga0181416_1074307All Organisms → cellular organisms → Bacteria805Open in IMG/M
3300017732|Ga0181415_1034323All Organisms → Viruses → Predicted Viral1166Open in IMG/M
3300017742|Ga0181399_1026938All Organisms → cellular organisms → Bacteria1578Open in IMG/M
3300017744|Ga0181397_1051593All Organisms → Viruses → Predicted Viral1138Open in IMG/M
3300017745|Ga0181427_1078450All Organisms → cellular organisms → Bacteria810Open in IMG/M
3300017748|Ga0181393_1046414All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium1197Open in IMG/M
3300017748|Ga0181393_1172216All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300017757|Ga0181420_1085099All Organisms → cellular organisms → Bacteria983Open in IMG/M
3300017764|Ga0181385_1003237All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium5572Open in IMG/M
3300017764|Ga0181385_1010712All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium2954Open in IMG/M
3300017769|Ga0187221_1049318All Organisms → Viruses → Predicted Viral1360Open in IMG/M
3300017771|Ga0181425_1015731All Organisms → Viruses → Predicted Viral2517Open in IMG/M
3300017776|Ga0181394_1041732All Organisms → Viruses → Predicted Viral1571Open in IMG/M
3300017776|Ga0181394_1077897All Organisms → Viruses → Predicted Viral1079Open in IMG/M
3300017781|Ga0181423_1355087All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300017782|Ga0181380_1176699All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300018424|Ga0181591_10471039All Organisms → cellular organisms → Bacteria921Open in IMG/M
3300020165|Ga0206125_10002169All Organisms → cellular organisms → Bacteria21120Open in IMG/M
3300020165|Ga0206125_10003573All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria14699Open in IMG/M
3300020165|Ga0206125_10020578All Organisms → Viruses → Predicted Viral3958Open in IMG/M
3300020185|Ga0206131_10456275All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300020340|Ga0211594_1006979All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium2628Open in IMG/M
3300020394|Ga0211497_10217320All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.726Open in IMG/M
3300020403|Ga0211532_10044012All Organisms → Viruses → Predicted Viral2155Open in IMG/M
3300020403|Ga0211532_10109631All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1172Open in IMG/M
3300020410|Ga0211699_10152955All Organisms → cellular organisms → Bacteria870Open in IMG/M
3300020417|Ga0211528_10328976All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium570Open in IMG/M
3300020428|Ga0211521_10059334All Organisms → cellular organisms → Bacteria1944Open in IMG/M
3300020428|Ga0211521_10421824All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300020430|Ga0211622_10037796All Organisms → Viruses → Predicted Viral2194Open in IMG/M
3300020430|Ga0211622_10143760All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1027Open in IMG/M
3300020437|Ga0211539_10110446All Organisms → Viruses → Predicted Viral1108Open in IMG/M
3300020438|Ga0211576_10022195All Organisms → Viruses → Predicted Viral3823Open in IMG/M
3300020464|Ga0211694_10083843All Organisms → cellular organisms → Bacteria1255Open in IMG/M
3300020469|Ga0211577_10342613All Organisms → cellular organisms → Bacteria936Open in IMG/M
3300020474|Ga0211547_10077883All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1750Open in IMG/M
3300020474|Ga0211547_10351167All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300021356|Ga0213858_10010252All Organisms → Viruses → Predicted Viral4425Open in IMG/M
3300021356|Ga0213858_10284945All Organisms → cellular organisms → Bacteria791Open in IMG/M
3300021365|Ga0206123_10132573All Organisms → Viruses → Predicted Viral1156Open in IMG/M
3300022068|Ga0212021_1123769Not Available529Open in IMG/M
3300022164|Ga0212022_1055083All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium614Open in IMG/M
(restricted) 3300022888|Ga0233428_1061011All Organisms → Viruses → Predicted Viral1498Open in IMG/M
3300025084|Ga0208298_1092744All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300025110|Ga0208158_1082947All Organisms → cellular organisms → Bacteria762Open in IMG/M
3300025120|Ga0209535_1104600All Organisms → cellular organisms → Bacteria1004Open in IMG/M
3300025120|Ga0209535_1155665All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300025132|Ga0209232_1028008All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium2170Open in IMG/M
3300025132|Ga0209232_1244756All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300025141|Ga0209756_1078766All Organisms → Viruses → Predicted Viral1486Open in IMG/M
3300025151|Ga0209645_1004324All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium6345Open in IMG/M
3300025151|Ga0209645_1024594All Organisms → Viruses → Predicted Viral2263Open in IMG/M
3300025151|Ga0209645_1024854All Organisms → Viruses → Predicted Viral2250Open in IMG/M
3300025151|Ga0209645_1029369All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium2032Open in IMG/M
3300025151|Ga0209645_1031713All Organisms → Viruses → Predicted Viral1942Open in IMG/M
3300025151|Ga0209645_1043711All Organisms → cellular organisms → Bacteria1598Open in IMG/M
3300025168|Ga0209337_1008353All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium6753Open in IMG/M
3300025168|Ga0209337_1020157All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium3904Open in IMG/M
3300025168|Ga0209337_1062410All Organisms → Viruses → Predicted Viral1874Open in IMG/M
3300025280|Ga0208449_1000561Not Available24494Open in IMG/M
3300025508|Ga0208148_1006559Not Available3748Open in IMG/M
3300025632|Ga0209194_1052417All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1163Open in IMG/M
3300025652|Ga0208134_1120699All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300025873|Ga0209757_10262464All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300027771|Ga0209279_10009028All Organisms → Viruses → Predicted Viral3572Open in IMG/M
3300027779|Ga0209709_10000621Not Available33563Open in IMG/M
3300027779|Ga0209709_10003300All Organisms → cellular organisms → Bacteria13482Open in IMG/M
3300027779|Ga0209709_10365288All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300027788|Ga0209711_10295731All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300027906|Ga0209404_10026471All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium3209Open in IMG/M
3300027906|Ga0209404_10086378All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1834Open in IMG/M
3300031519|Ga0307488_10747872All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300031605|Ga0302132_10292094All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300031623|Ga0302123_10258830All Organisms → cellular organisms → Bacteria854Open in IMG/M
3300032073|Ga0315315_10182688All Organisms → Viruses → Predicted Viral1958Open in IMG/M
3300032088|Ga0315321_10360117All Organisms → cellular organisms → Bacteria913Open in IMG/M
3300032138|Ga0315338_1003879All Organisms → cellular organisms → Bacteria12447Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine36.17%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater17.73%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine13.48%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous7.80%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater3.55%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean2.84%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine2.84%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine2.84%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater2.13%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater2.13%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater1.42%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater1.42%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater0.71%
MarineEnvironmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine0.71%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.71%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.71%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.71%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.71%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.71%
Marine Benthic Sponge Stylissa Massa AssociatedHost-Associated → Porifera → Unclassified → Unclassified → Unclassified → Marine Benthic Sponge Stylissa Massa Associated0.71%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300001974Marine microbial communities from Upwelling, Fernandina Island, Equador - GS031EnvironmentalOpen in IMG/M
3300002483Marine viral communities from the Pacific Ocean - ETNP_6_30EnvironmentalOpen in IMG/M
3300005074Marine benthic sponge Stylissa massa associated microbial communities from Guam, USAHost-AssociatedOpen in IMG/M
3300005433Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45BEnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006165Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNAEnvironmentalOpen in IMG/M
3300006190Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNAEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006753Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006841Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT234_2_0200mEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300006928Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaGEnvironmentalOpen in IMG/M
3300007229Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007283Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_250_ad_252m_LV_BEnvironmentalOpen in IMG/M
3300007510Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 267m, 250-2.7um, replicate aEnvironmentalOpen in IMG/M
3300007512Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 247m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300008219Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05EnvironmentalOpen in IMG/M
3300008220Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908EnvironmentalOpen in IMG/M
3300009108Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 234m, 2.7-0.2um, replicate aEnvironmentalOpen in IMG/M
3300009413Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12EnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009425Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136EnvironmentalOpen in IMG/M
3300009426Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420EnvironmentalOpen in IMG/M
3300009433Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330EnvironmentalOpen in IMG/M
3300009435Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413EnvironmentalOpen in IMG/M
3300009512Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88EnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300010150Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaGEnvironmentalOpen in IMG/M
3300010153Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaGEnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300012928Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaGEnvironmentalOpen in IMG/M
3300012950Marine microbial communities from the Central Pacific Ocean - Fk160115 155m metaGEnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017705Marine viral communities from the Subarctic Pacific Ocean - Lowphox_08 viral metaGEnvironmentalOpen in IMG/M
3300017706Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaGEnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017720Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23EnvironmentalOpen in IMG/M
3300017728Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24EnvironmentalOpen in IMG/M
3300017729Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11EnvironmentalOpen in IMG/M
3300017731Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16EnvironmentalOpen in IMG/M
3300017732Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017744Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23EnvironmentalOpen in IMG/M
3300017745Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15EnvironmentalOpen in IMG/M
3300017748Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21EnvironmentalOpen in IMG/M
3300017757Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22EnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300017769Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2)EnvironmentalOpen in IMG/M
3300017771Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13EnvironmentalOpen in IMG/M
3300017776Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300018424Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300020185Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1EnvironmentalOpen in IMG/M
3300020340Marine microbial communities from Tara Oceans - TARA_B100001121 (ERX555960-ERR599119)EnvironmentalOpen in IMG/M
3300020394Marine microbial communities from Tara Oceans - TARA_B000000557 (ERX556068-ERR599026)EnvironmentalOpen in IMG/M
3300020403Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145)EnvironmentalOpen in IMG/M
3300020410Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148)EnvironmentalOpen in IMG/M
3300020417Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556034-ERR599082)EnvironmentalOpen in IMG/M
3300020428Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094)EnvironmentalOpen in IMG/M
3300020430Marine microbial communities from Tara Oceans - TARA_B100000683 (ERX556126-ERR599160)EnvironmentalOpen in IMG/M
3300020437Marine microbial communities from Tara Oceans - TARA_B100000282 (ERX555906-ERR599074)EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300020464Marine microbial communities from Tara Oceans - TARA_B100000530 (ERX556075-ERR599101)EnvironmentalOpen in IMG/M
3300020469Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052)EnvironmentalOpen in IMG/M
3300020474Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976)EnvironmentalOpen in IMG/M
3300021356Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300022068Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2)EnvironmentalOpen in IMG/M
3300022164Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2)EnvironmentalOpen in IMG/M
3300022888 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_120_MGEnvironmentalOpen in IMG/M
3300025084Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025110Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025132Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes)EnvironmentalOpen in IMG/M
3300025141Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes)EnvironmentalOpen in IMG/M
3300025151Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025168Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)EnvironmentalOpen in IMG/M
3300025280Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 (SPAdes)EnvironmentalOpen in IMG/M
3300025508Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025632Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes)EnvironmentalOpen in IMG/M
3300025652Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes)EnvironmentalOpen in IMG/M
3300025873Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes)EnvironmentalOpen in IMG/M
3300027771Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027779Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes)EnvironmentalOpen in IMG/M
3300027788Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes)EnvironmentalOpen in IMG/M
3300027906Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031605Marine microbial communities from Western Arctic Ocean, Canada - CB9_32.1EnvironmentalOpen in IMG/M
3300031623Marine microbial communities from Western Arctic Ocean, Canada - CB21_32.1EnvironmentalOpen in IMG/M
3300032073Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416EnvironmentalOpen in IMG/M
3300032088Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515EnvironmentalOpen in IMG/M
3300032138Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - ASW #8EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI24006J15134_10002566183300001450MarineMKIGDLVKWENVLNDSMDHHQEEHGIIIKMSRTGHETESAQVLLTDGETWWLDTQHLEVINESR*
GOS2246_1000877113300001974MarineVGDLVKWMTVLNDDMDRYREELGLVIKMSRTGHNTESAQVLFNDGETWWVDTQRLVVINESR*
JGI25132J35274_1006745103300002483MarineMKIGDLVKWESVLNDSMDYHTVEYGIVTKMSRTGHTTFSAEVLFNDGETAWFDTQTLEIVSEGR*
JGI25132J35274_1008736103300002483MarineMKVGDLVKWENVLNDSMDHYRVDYGVIIKMSKTGHSTHSAQVLFNDGELAWFDTQQLIVVSAH*
JGI25132J35274_101102273300002483MarineMKVGDLVKWVSVLNDSMDYYTEEYGLVLQLSKTGHKTKSAQILFNDGETAWFDTQRLVVVSESR*
Ga0070431_103745993300005074Marine Benthic Sponge Stylissa Massa AssociatedMKVGDLVKWESVLNDSMDYHTEEYGVILKMSKTGHKTKSAQVLFTDGETAWFDTQFLEVVSAHR*
Ga0066830_1005202733300005433MarineMKVGDLVKWESVLNDSMDHYYSDYGIVIKLSKTGHKTKSAEVLFTDGKTAWFDTQRLIIVNGNR*
Ga0075466_1003813183300006029AqueousVKVGDLVKWENTLNDSMDHYQQQHGIVVKMSRTGHNTESAQVLFTDGELWWLDKEKLMVINESG*
Ga0075466_1026955103300006029AqueousVGNVLNDSMDHHREDHGIVIKMSRTGHDSESAQILFTDGELWWVDIQKLEIVNEAG*
Ga0075443_1002336923300006165MarineMKVGDLVRWENVLYDSMDHHREEHGLVVQMSRTGHDTESAQVLFNDGETWWLDTQKLVVISESR*
Ga0075446_1013724623300006190MarineVKVGDLVRWENVIYDSMDHHREEHGIVVQMSRTGHDTESAQVLFNDGETWWLDSEKLVVVSEAGR*
Ga0098048_108150633300006752MarineVKVGDLVKWENVLNDSMDHHRKDHGIVIKMSRTGHDSESAQVLFTDGEMWWFDTRKLEVVNES*
Ga0098039_122677313300006753MarineRRSLMKVGDLVRWENVLNDSMDHYRADYGIVIKMSRTGHDTDSANVMFNSGDTVWLDTKTLEVINEQH*
Ga0098054_102308883300006789MarineMKVGDLVRWEKVLNDSMDRHRVEHGLVINMSRTGHDSESAQVLFTDGDMWWFDTRKLEVVNES*
Ga0098054_108596323300006789MarineVKVGDLVKWENVFNDSMDHHQEDHGLVIKMSRTGHNTESAQVLFTDGETWWLDTQKLEVVNESK*
Ga0098055_109411523300006793MarineVKVGDLVRWENVLNDSMDHHRVDHGLVIKMSRTGHDSESAQVLFTDGEMWWFDTRKLEVVNES*
Ga0068489_14070813300006841MarineMKVGDLVKWMTVLNDDMDRYREELGLVVKMSRTGHNTESAQVLFNDGETWWVDTQRLVVINESR*
Ga0070750_10001997133300006916AqueousMKVGDLVKWENVLNDSMDHYRIDYGVVIKMSKTGHTTHSAQVLFNDGELAWFDTQQLIVVSPH*
Ga0098051_114499323300006924MarineVKVGDLVRWENVLNDSMDHHRVDHGLVIKMSRTGHDSESAQVLFTDGEMWWFD
Ga0098041_101733973300006928MarineMKVGDLVKWENVLNDSMDHHREDHGIVIKMSRTGHDTESAQVLFTDGETWWLDTQKLEVVNESK*
Ga0075468_1001421273300007229AqueousMKVGDLVKWENVLNDSMDHHREDHGIVIKMSRTGHDSESAQILFTDGELWWVDIQKLEIVNEAG*
Ga0075468_1006636713300007229AqueousWENVLNDSMDHHREDHGIVIKMSRTGHDSESAQILFTDGELWWLDTQKLRVVNEAG*
Ga0070747_103556983300007276AqueousMKVGDLVKWESVMNDSMDHYSVDYGIVVKMSRTGHLTESAEVLFNDGDTVWFDTQRLAVVSESR*
Ga0070747_109444743300007276AqueousMKVGDLVKWENVLNDSMDHHREDHGIVVKMSRTGHDTLSAQVLFTDGELWWMDTQKLEIVNEAG*
Ga0066366_1027845313300007283MarineMKVGDLVKWMTVLNDDMDRYQEELGLVIKMSRTGHNTESAQVLFNDGETWWVDTQRLVVINESR*
Ga0105013_106566243300007510MarineMRRMKVGDLVKWMNVLNDDMDRYQEEHGLVIKMSRTGHDTESAQVLFNDGETWWLDTQNLVVVSESR*
Ga0105016_112519433300007512MarineMKVGDLVKWMTVLNDDMDRYREELGLVIKMSRTGHNTESAQVLFNDGETWWVDTQRLVVINESR*
Ga0105019_101458953300007513MarineMKVGDLVKWMNVLNDDMDRYQEEHGLVIKMSRTGHDTESAQVLFNDGETWWLDTQNLVVVSESR*
Ga0114905_126843113300008219Deep OceanMKVGDLVKWMTVLNDDMDRYREELGLVIKMSRTGHNTESAQVLFSDGETWWVDTQRLVVINESR*
Ga0114910_118036323300008220Deep OceanMKVGDLVKWESVMNDSMDHYSVDYGIVVKMSRTGHLTESAEVLFNDGDTAWFDTQRLAVVSESR*
Ga0117920_100891043300009108MarineMKVGDLVKWVTVLNDDMDRYQEELGLVIKMSRTGHNTESAQVLFNDGETWWVDTQRLVVINESR*
Ga0114902_1019861103300009413Deep OceanMKVGDLVKWMTVLNDDMDRYQEELGLVIKMSRTGHNTESAQVLFNDGETWWVDTQR
Ga0114994_1059144613300009420MarineMKVGDLVKWDKSAAYSTMDHHVEEHGLVVQMSRTGHNTESAQVLFNDGQTWWLDSDKLVVVSESR*
Ga0114994_1104941513300009420MarineVRWENVIYDSMDHHREEHGIVVQMSRTGHDTESAQVLFNDGETWWLDSEKLVVVSEAGR*
Ga0114997_1030484423300009425MarineMKVGDLVRWENVIYDSMDHHQEQHGLVVQMSRTGHDTESAQVLFSDGETWWLDTQKLVVVNG*
Ga0114997_1067403123300009425MarineMKVGDLVKWENVILDSMDHHREEHGLVVKMSRTGHDTESVQVLLNDGDTWWLDSDKLVVVSESR*
Ga0115547_122037513300009426Pelagic MarineMKMKVGDLVRWESVLNDSMDHHRVDHGLVIKMSRTGHDSESAQVLFTDGEIWWLDTHKLEVVNESK*
Ga0115545_106121543300009433Pelagic MarineMKMKVGDLVRWESGLNDSMDHHRVDHGLVIKMSRTGHDSESAQVLFTDGEIWWLDTHKLEVVNESK*
Ga0115546_129924323300009435Pelagic MarineMKRAIIVKVGDLVKWESVLNDSMDRHQEDHGLVIKMSRTGHKTESAQVLFTDGEWFWVDTQNLEVVSASG*
Ga0115003_1026943623300009512MarineMKVGDLVKWENVILDSMDRYREEHGLVVKMSRTGHNTESAQVLFSDGETWWLDSDKLVLVSESR*
Ga0115011_10013120173300009593MarineMKVGDLVKWENVLNDSMDHHREDHGIVIKMSRTGHDTESAQVLFTDGETWWLDTQRLEIVNETK*
Ga0115011_1032315823300009593MarineVKVGDLVRWENVLNDSMDHHRADHGLVIKMSRTGHDSESAQVLFTDGEMWWFDTRKLEVVNES*
Ga0098056_126800223300010150MarineKMKVGDLVKWENVLNDSMDHHREDHGIVIKMSRTGHDTESAQVLFTDGETWWLDTQKLEVVNESK*
Ga0098059_106555323300010153MarineVKVGDLVKWENVFNDSMDHHQEDHGLVIKMSRTGHNTESAQVLFTDGETFWVDTQRLEIVNETK*
Ga0133547_1024673663300010883MarineVKVGDLVKWENLIFDSTDHHREEFGLVVQMSKTGHTTISAQVLFNDGETWWLDTQKLVVVSESR*
Ga0133547_1068161583300010883MarineMKVGDLVKWESVIFDSMDHHREEHGLVVQMSRTGHDTESAQVLFVDGETWWLDTQKLVVVSESK*
Ga0163110_1008228813300012928Surface SeawaterMKVGDLVKWVSVLNDSMDHFATEYGIVTKMSRTGHTTESAQVLFNDGQVAWFDTQRLVVVSEGR*
Ga0163108_1000266163300012950SeawaterMKVGDLVKWMTVLNDDMNRYQEELGLVIKMSRTGHNTESAQVLFNDGETWWVDTQRLVVINESR*
Ga0163180_1000353283300012952SeawaterVKVGDLVKWESVLNDSMDHYSVDYGIVIKMSRTGHKTNSAEVLFSDGDIQWFDTERLVVVSANR*
Ga0163179_10002928193300012953SeawaterVGDLVKWENVLNDSMDHHRQDHGIVIKMSRTGHDSESAQVLFTDGDLWWLDTQKLVVVNEAG*
Ga0163179_1132453123300012953SeawaterVKVGDLVKWENVLNDSMDRHCSDYGIVIKMSITGHKTKSAEVLFTDGRTAWFDTQRLVLVNENR*
Ga0163111_1110288523300012954Surface SeawaterMKVGDLVKWESVLNDSMDHYAVDYGIVVKMSKTGHITKSAEVLFSDGTTSWFDTQRLVVVSESG*
Ga0180120_1019476523300017697Freshwater To Marine Saline GradientMKVGDLVKWESVMNDSMDHYSVDYGIVVKMSRTGHLTESAEVLFNDGDTAWFDTQRLAVVSESR
Ga0181372_101556413300017705MarineIIVKVGDLVKWENVFNDSMDHHQEDHGLVIKMSRTGHNTESAQVLFTDGETFWVDTQRLEIVNETK
Ga0181377_105674333300017706MarineMKVGDLVKWESVMNDSMDHYSVDYGVVVKMSRTGHLTESAEVLFNDGDTAWFDTQRLAVVSESR
Ga0181387_108281343300017709SeawaterMKVGDLVKWENVLNDSMDHHRVDHGLVIKMSRTGHDTESAQVLFTDGEMWWFDTRKLEVVNES
Ga0181403_1000427243300017710SeawaterMKVGDLVKWESVLNDSMDHHSEDHGIVVKMSRTGHDSESAQILFTDGELWWMDTRKLRIVNEAG
Ga0181391_109240123300017713SeawaterMKVGDLVKWESVMNDSMDHHSVDYGVVVKMSRTGHLTESAEVLFNDGETAWFDTQRLAVVSESR
Ga0181390_113948233300017719SeawaterVKWENVLNDSMDHHREDHGIVIKMSRTGHDTESAQVLFTDGETWWLDTQRLEIVNETK
Ga0181383_101947363300017720SeawaterMKVGDLVKWENVLNDSMDHHRVDHGLVIKMSRTGHDSESAQVLFTDGDMWWFDTKKLEVVNES
Ga0181383_105268613300017720SeawaterMKVGDLVKWENVLNDSMDRHREDHGIVIKMSRTGHDTESAQVLFTDGEMWWFDTRKLEVVNES
Ga0181383_109579353300017720SeawaterMKVGDLVKWENVLNDSMDHHREDHGIVIKMSRTGHDSESAQILFTDGELWWVD
Ga0181419_102291613300017728SeawaterKNESCFYLCILVRVQCFLLDDSTMKVGDLVKWESVLNDSMDHHSEDHGIVIKMSRTGHDSESAQILFTDGELWWVDTQKLEIVNEAG
Ga0181396_111456233300017729SeawaterVNGCYNIYMKVGDLVKWENVLNDSMDHHREDHGIVIKMSRTGHDSESAQILFTDGELWWVDIQKLEIVNEAG
Ga0181416_107430713300017731SeawaterVPDLRDTGGSVKVGDLVKWESVLNDSMDHHRQDHGIVIKMSRTGHDSESAQVLFTDGELWWLDTQKLVVVNEAG
Ga0181415_103432333300017732SeawaterMKVGDLVKWENVLNDSMDHHRQDHGIVIKMSRTGHDSESAQVLFTDGELWWLDTQKLVVVNEAG
Ga0181399_102693823300017742SeawaterMKVGDLVKWENVLNDSMDHHREDHGIVIKMSRTGHDSESAQILFTDGELWWVDTQKLEIVNEAG
Ga0181397_105159353300017744SeawaterRLKMKVGDLVKWENVLNDSMDHHREDHGIVIKMSRTGHDTESAQVLFTDGETWWLDTQRLEIVNETK
Ga0181427_107845023300017745SeawaterVKVGDLVKWENVLNDSMDHHRQDHGIVIKMSRTGHDSESAQVLFTDGELWWLDTQKLVVVNEAG
Ga0181393_104641463300017748SeawaterKVGDLVKWENVLNDSMDHHREDHGIVIKMSRTGHDSESAQILFTDGELWWVDTQKLEIVNEAG
Ga0181393_117221623300017748SeawaterMKVGDLVKWENVLNDSMDRHREDHGIVIKMSRTGHDSESAQVLFTDGDMWWFDTKKLEVVNES
Ga0181420_108509953300017757SeawaterMKVGDLVKWENVLNDSMDHHRQDHGIVVKMSRTGHDSESAQVLFTDGDLWWLDTQKLVVVNEAG
Ga0181385_1003237193300017764SeawaterVKVGDMVKWENVLNDSMDHHREDHGIVVKMSRTGHDSESAQILFTDGELWWMDTRKLRIVNEAG
Ga0181385_101071233300017764SeawaterMKVGDLVRWETVLNDSMDHHRVDHGLVIKMSRTGHDSESAQVLFTDGEICWLDTHKLEVVNESG
Ga0187221_104931823300017769SeawaterVKVGDLVKWENVLNDSMDHHRQDHGIVVKMSRTGHDSESAQVLFTDGDLWWLDTQKLVVVNEAG
Ga0181425_101573113300017771SeawaterVQCFLLDDSTMKVGDLVKWESVLNDSMDHHSEDHGIVVKMSRTGHDSESAQILFTDGELWWMDTRKLRIVNEAG
Ga0181394_104173233300017776SeawaterMKVGDLVKWESVLNDSMDHHRQDHGIVVKMSRTGHDSESAQVLFTDGDLWWLDTQKLVVVNEAG
Ga0181394_107789743300017776SeawaterVKVGDLVKWENVLNDSMDHHREDHGIVIKMSRTGHDSESAQILFTDGELWWVDTQKLEIVNEAG
Ga0181423_135508713300017781SeawaterGDLVKWENVLNDSMDHHREDHGIVIKMSRTGHDSESAQILFTDGELWWVDTQKLEIVNEA
Ga0181380_117669913300017782SeawaterNVLNDSMDHHRVDHGLVIKMSRTGHDSESAQVLFTDGDMWWFDTKKLEVVNES
Ga0181591_1047103923300018424Salt MarshVKVGDLVRWEHVLNDDMDYFCASYGVILQMSKTGHKTESAQVLFTDGEVAWFDTQRLEVVSASR
Ga0206125_10002169313300020165SeawaterVKVGDLVKWENVLNDSMDHHREDHGIVVKMSRTGHDSESAQILFTDGELWWVDTQKLMVVNEAGG
Ga0206125_10003573353300020165SeawaterMKVGDLVRWENVLNDSMDHHRVDHGLVIKMSRTGHDSESAQVLFTDGEMWWFDTEKLEVVNES
Ga0206125_10020578143300020165SeawaterMKVGDLVKWENALNDSMDHHREDHGIVVKMSRTGHDSESAQILFTDGELWWMDTQKLRIVNEAG
Ga0206131_1045627533300020185SeawaterVKVGDLVKWENVLNDSMDHHREDHGIVVKMSRTGHDSESAQILFTDGELWWVDTQKLMVVNEAG
Ga0211594_100697953300020340MarineVKVGDLVSWESVLNDSMDYHTKSYGLVLQISKTGHKTKSAQVLFAGGETVWFDTQVLEVVSASR
Ga0211497_1021732023300020394MarineVKVGDLVRWENVLNDSMDHYRADYGVIINMSRTGHTTHSAQVLFSDGELAWFDTQSLEVVSEAGR
Ga0211532_1004401223300020403MarineMKVGDLVKWENVLNDSMDHYRTDYGVIIKMSRTGHTTHSAQVLFSDGELAWFDTQSLEVVNESR
Ga0211532_1010963133300020403MarineMKVGDLVKWESVLNDSMDYHTEDYGVILKLSRTGHKTKSAQVLFIDGETAWFDTQFLEVVSACR
Ga0211699_1015295523300020410MarineMKVGDLVKWVSVLNDSMDHFAVEYGIVTKMSRTGHTTESAEVLFNNGETAWFDTQRLVVVSESG
Ga0211528_1032897623300020417MarineMKVGDLVKWESVLNDSMNHFSVDYGIVIKMSRTGHTTKSAEVLFSDGETAWFDTQRLEVISESR
Ga0211521_1005933453300020428MarineMKIGDLVKWENVMNDSMDRYREDHGIVVKMSRTGHDTESAQVLFTDGELWWLDTQNLEIVNESR
Ga0211521_1042182423300020428MarineMKVGDLVKWENVLNDSMDHHREDHGIVVKMSRTGHDTESAQILFTDGELWWMDTQKLRVVNEAG
Ga0211622_1003779673300020430MarineMKVGDLVKWESVLNDSIDYYTEEYGLVLQLSKTGHKTKSAQVLFNDGETAWFDTQRLVVVSESR
Ga0211622_1014376023300020430MarineMRVGDLVKWESALNDSMDHYTEEYGVILKMSKTGHKTKSAQVLFTDGETAWFDTQFLEVISARR
Ga0211539_1011044623300020437MarineMKVGDLVKWENALNDSMDHYRTDYGVIIKMSRTGHTTHSAQVLFSDGELAWFDTQSLEVVSEGR
Ga0211576_1002219563300020438MarineVKVGDLVKWESVLNDSMDHHRQDHGIVVKMSRTGHDSESAQVLFTDGDLWWLDTQKLVVVNEAG
Ga0211694_1008384333300020464MarineMQLLFAKGKSQMKVGDLVKWMNVLNDDMDRYREQLGLVVKMSKTGQNTESAQVLFNDGESWWVDTQRLVVINESG
Ga0211577_1034261353300020469MarineRTGAVPDLRDTGGSVKVGDLVKWESVLNDSMDHHRQDHGIVVKMSRTGHDSESAQVLFTDGDLWWLDTQKLVVVNEAG
Ga0211547_1007788323300020474MarineVKVGDLVKWENVLNDSMDRHCSDYGIVIKMSITGHKTKSAEVLFTDGRTAWFDTQRLVLVNENR
Ga0211547_1035116733300020474MarineVKVGDLVKWENVLNDSMDHHRQDHGIVIKMSRTGHDSESAQVLFTDGDLWWLDTQKLVVVNEAG
Ga0213858_10010252173300021356SeawaterMKVGDLVKWENVLNDSMDHYRIDYGVVIKMSKTGHTTHSAQVLFNDGELAWFDTQQLIVVSPH
Ga0213858_1028494523300021356SeawaterMKVGDLVKWESVLNDSMDYYTEEYGLVLQLSKTGHKTKSAQVLFNDGETAWFDTQRLVVVSESR
Ga0206123_1013257323300021365SeawaterVKVGDLVKWESVLNDSMDRHQEDHGLVIKMSRTGHKTESAQVLFTDGEWFWVDTQNLEVVSASG
Ga0212021_112376913300022068AqueousMKVGDLVKWENVLNDSMDHYRIDYGVVIKMSKTGHTTHSAQVLFNDGELAWFDT
Ga0212022_105508323300022164AqueousVKVGDLVKWENTLNDSMDHYQQQHGIVVKMSRTGHNTESAQVLFTDGELWWLDKEKLMVINESG
(restricted) Ga0233428_106101133300022888SeawaterMKVGDLVKWENVLNDSMDHHREDHGVVVKMSRTGHDSESAQILFTDGELWWMDTQKLRVVSEAG
Ga0208298_109274423300025084MarineMKVGDLVKWENVLNDSMDHHREDHGIVIKMSRTGHDSESAQVLFTDGEMWWFDTRKLEVVNES
Ga0208158_108294723300025110MarineMKVGDLVKWENVLNDSMDHHREDHGIVIKMSRTGHDTESAQVLFTDGETWWLDTQKLEVVNESK
Ga0209535_110460023300025120MarineVRIGDLVKWENVLNDSMDHHREDHGIVVKMSRTGHDSESAQILFTDGELWWVDTQKLRIVNEAG
Ga0209535_115566513300025120MarineASGCYNIYMKVGDLVKWENVLNDSMDHHREDHGIVIKMSRTGHDSESAQILFTDGELWWVDIQKLEIVNEAG
Ga0209232_102800823300025132MarineMKVGDLVKWESVLNDSMDYYTKEYGVILKMSKTGHKTKSAQVLFTDGDTAWFDTQKLVVVSASR
Ga0209232_124475623300025132MarineMKVGDLVKWESVLNDSMDHFNVEYGIVTKMSRTGHTTESAQVLFNDGETAWFDTQRLVVVSEGR
Ga0209756_107876643300025141MarineVKVGDLVKWENALTDSMDHYQQQHGIIVQMSRTGHDTFSAQVLFTDGDLWWMDTHKLVVVNESR
Ga0209645_1004324193300025151MarineMKVGDLVKWESVLNDSMDHYYSDYGIVIKLSKTGHKTKSAEVLFTDGKTAWFDTQRLIIVNGNR
Ga0209645_102459443300025151MarineVKVGDLVKWENVLNDSMDHYRTDYGVIIKMSRTGHTTHSAQVLFSDGELAWFDTQSLEVVSEGR
Ga0209645_102485473300025151MarineMKVGDLVKWVSVLNDSMDYYTEEYGLVLQLSKTGHKTKSAQILFNDGETAWFDTQRLVVVSESR
Ga0209645_102936913300025151MarineMKVGDLVKWQSVLNDSMDYHTVEYGIVTKMSKTGHTTKSAQVLFTDGETAWFDTQFLEVVSASR
Ga0209645_103171323300025151MarineMKVGDLVKWENVLNDSMDHYRVDYGVIIKMSKTGHSTHSAQVLFNDGELAWFDTQQLIVVSAH
Ga0209645_104371133300025151MarineMKIGDLVKWESVLNDSMDYHTVEYGIVTKMSRTGHTTFSAEVLFNDGETAWFDTQTLEIVSEGR
Ga0209337_100835383300025168MarineMKIGDLVKWENVLNDSMDHHQEEHGIIIKMSRTGHETESAQVLLTDGETWWLDTQHLEVINESR
Ga0209337_1020157113300025168MarineMKVGDLVKWDKNAVYSTVDHHREEHGLVVQMSRTGHDTESAQVLFNDGETWWLDSEKLVVISESR
Ga0209337_106241043300025168MarineMKVGDLVKWENVLNDSMDHHREDHGIVIKMSRTGHDSESAQILFTDGELWWVDIQKLEIVNEAG
Ga0208449_100056113300025280Deep OceanVKVGDLVKWVNVLNDDMDRYREELGLVVKMSKTGHNTESAQVLFNDGETWWVDTQR
Ga0208148_1006559173300025508AqueousVKVGDLVKWENTLNDSMDHYQQQHGIVVKMSRTGHNTESAQVLFTDGELWWLD
Ga0209194_105241733300025632Pelagic MarineMKVGDLVRWESVLNDSMDHHRVDHGLVIKMSRTGHDSESAQVLFTDGEIWWLDTHKLEVVNESK
Ga0208134_112069923300025652AqueousMKVGDLVKWESVMNDSMDHYSVDYGIVVKMSRTGHLTESAEVLFNDGDTVWFDTQRLAVVSESR
Ga0209757_1026246423300025873MarineMKVGDLVKWMNVLNDDMDRYREEHGLVIKMSRTGHDTESAQVLFNDGETWWLDTQKLVVVSESR
Ga0209279_1000902853300027771MarineMKVGDLVRWENVLYDSMDHHREEHGLVVQMSRTGHDTESAQVLFNDGETWWLDTQKLVVISESR
Ga0209709_10000621533300027779MarineVKVGDLVRWENVIYDSMDHHREEHGIVVQMSRTGHDTESAQVLFNDGETWWLDSEKLVVVSEAGR
Ga0209709_10003300273300027779MarineMKVGDLVRWENVIYDSMDHHQEQHGLVVQMSRTGHDTESAQVLFSDGETWWLDTQKLVVVNG
Ga0209709_1036528833300027779MarineVKVGDLVKWENLIFDSTDHHREEFGLVVQMSKTGHTTISAQVLFNDGETWWLDTQKLVVVSESR
Ga0209711_1029573133300027788MarineMKVGDLVKWENVILDSMDRYREEHGLVVKMSRTGHNTESAQVLFSDGETWWLDSDKLVLVSESR
Ga0209404_1002647183300027906MarineMKVGDLVKWENVLNDSMDHHREDHGIVIKMSRTGHDTESAQVLFTDGETWWLDTQRLEIVNETK
Ga0209404_1008637843300027906MarineVKVGDLVRWENVLNDSMDHHRADHGLVIKMSRTGHDSESAQVLFTDGEMWWFDTRKLEVVNES
Ga0307488_1074787223300031519Sackhole BrineVKVGDLVKWENVVLDSMDHYQEELGLVVKMSRTGHNTESAQVLFNDGETWWLDSNKLVVVNG
Ga0302132_1029209443300031605MarineVKRNLMKVGDLVKWDKSAVYSTVDHHREEHGLVVQMSRTGHTTTSAQVLFNDGETWWLDIQKLVVVSEAGR
Ga0302123_1025883023300031623MarineMKVGDLVKWDKSAVYSTVDHHREEHGLVVQMSRTGHTTTSAQVLFNDGETWWLDIQKLVVVSEAGR
Ga0315315_1018268853300032073SeawaterVKVGDLVKWENVLNDSMDHHREDHGIVVKMSRTGHDSESAQILFTDGELWWMDTRKLRIVNEAG
Ga0315321_1036011733300032088SeawaterVKVGDLVKWENVFNDSMDHHQEDHGLVIKMSRTGHNTESAQVLFTDGETFWVDTQRLEIVNETK
Ga0315338_1003879273300032138SeawaterMKVGDLVKWMNVLNDDMDRYREELGLVVKMSKTGHNTESAQVLFNDGETWWVDIQRLVVINESR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.