Basic Information | |
---|---|
Taxon OID | 3300020470 Open in IMG/M |
Scaffold ID | Ga0211543_10577390 Open in IMG/M |
Source Dataset Name | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | CEA Genoscope |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 529 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | TARA_041 | |||||||
Coordinates | Lat. (o) | 14.5375 | Long. (o) | 70.0244 | Alt. (m) | Depth (m) | 60 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F051973 | Metagenome | 143 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0211543_105773901 | F051973 | AGGAG | MGLRIGIDCDGVLRDFIPDLIEGIKTTHPEHADKILVPR |
⦗Top⦘ |