Scaffold Ga0211574_10013577

Overview

Basic Information

• Taxon OID: 3300020446
• Scaffold ID: Ga0211574_10013577
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100001287 (ERX556031-ERR598989)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3910
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_137
• Coordinates
  • Lat. (^o): 14.2017
  • Long. (^o): -116.6336
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F084116	Metagenome / Metatranscriptome	112	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211574_100135771	F084116	GAGG	MKKDNINLYQVPIIKIYRVKQYWSDWLKYRLPIPKKITPYKLKNLLGGYK